KEGG   Cucumis sativus (cucumber): 101205988Help
Entry
101205988         CDS       T02486                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00010  Glycolysis / Gluconeogenesis
csv00562  Inositol phosphate metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101205988
   00562 Inositol phosphate metabolism
    101205988
Enzymes [BR:csv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101205988
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101205988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101205988
NCBI-ProteinID: XP_011656186
Position
5
AA seq 464 aa AA seqDB search
MGYGASKGDRPASVSAPPNGCIPIYLNLVARHGTRAPTTKRIKELNNLENELKKLLGANV
GNDDHLFSLPSWLKDWKSPWAAKINGGELIPEGEKELYDLGIQTKKLFSDLFIDPYNSDI
YTIKATQVARASASAVAFGMGLFSGNGNLGSDRHRAFSVVTESRANDTMLRFFDRCHKYE
DYKKDQKPKVEELKEPVLVDITKSVTARYGLKFTPKHISTLWFLCKQEASLFDTTDQACG
LFTPSEVALLEWTDDMEVFILKGYGNSLNYRMGVHLLEDVVNSMDKAIYNKEKKQVPGTY
EKARLRFSHAETLIPFTCLLGLFLEEGKGFKQIRREQSLELPPRPPTTRNWKVRNVSPFA
GNNMLVLYSCHVANSSDEYFVRVLHNEEPIAMPGCDGSDFCSFKKFKDKIVSPHLKHDFH
TLCTVNKEESVVTLESNHQQEHTSNNPGFTCNQEFTHHKENPIS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggatatggtgcatcgaaaggtgatcgacctgcttctgtttctgctcctccgaatgga
tgcattccaatttacttaaatcttgtggcaagacatggaactcgtgctccaaccacaaaa
aggatcaaagagttaaacaacttggaaaatgaattgaagaaacttttaggagctaatgta
ggaaatgacgatcacttattttctcttccttcctggttgaaggattggaaatctccttgg
gctgcaaaaattaatggtggagaattaatccccgaaggagagaaagaattgtacgatctc
ggaatccaaaccaaaaaattgttctctgacttgttcatcgatccttacaactccgatata
tacacaatcaaagcaactcaggttgctcgagcatcagctagtgctgtggcattcggtatg
gggctattcagtgggaatggaaatcttggttcagatcgtcatcgagctttttctgttgtt
actgagagtcgtgccaacgataccatgcttaggtttttcgatcggtgtcacaaatatgag
gattacaagaaggatcagaaacctaaagttgaggagcttaaggaacctgtacttgttgat
ataactaagtcagtcactgcacgttatggtctaaaatttaccccaaaacacatttcaact
ttgtggtttctttgtaagcaggaggcatccttatttgacacaacggatcaagcctgtgga
ctgttcaccccttctgaggttgctttgttggagtggacggatgatatggaggtgtttata
ttgaagggttatggaaattcattaaattataggatgggagttcatttgttggaagatgtt
gttaactccatggacaaagctatctacaacaaagaaaaaaaacaagttcccggaacctat
gagaaggcaagacttcgtttttctcatgctgaaactttgattccattcacatgtttgttg
gggctcttccttgaagaaggaaaaggatttaaacaaatccgaagggagcagtctttagag
cttcctccacggcctccaactactagaaactggaaggtaagaaatgtttcaccttttgct
gggaataacatgttggttctctatagctgccatgtggctaactcgtccgacgagtacttt
gttcgagtcttgcataatgaagaacccatagcaatgccgggttgtgatggttcagatttt
tgctcctttaaaaagttcaaggataaaattgtgtctcctcatctcaagcatgatttccac
acattgtgcactgtgaataaggaagagtcagtagtgacactggaatcaaatcatcaacag
gagcatacatcgaataatccaggttttacatgtaaccaagagtttactcaccacaaggaa
aacccgatttcttga

DBGET integrated database retrieval system