KEGG   Cucumis sativus (cucumber): 101206190Help
Entry
101206190         CDS       T02486                                 

Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00600  Sphingolipid metabolism
csv01100  Metabolic pathways
Module
csv_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101206190
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     101206190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 101206190
NCBI-ProteinID: XP_004134960
UniProt: A0A0A0KK35
Position
6
AA seq 491 aa AA seqDB search
MDQSGDSDFILNHRVLLPDGTVTPMILTTDGWLQWSEKSQRRLSVDKEVLGFSMDGPKIR
IKALVEDHGGLRCFGSSGALVRKEFVFQPLSEESRALWCLKLRECIDLIGRPKKLFVLVN
PFGGKGTGSKIYRDEVKPILEDAEIDVTLQETKYQRHAEEVAYSLDFTNYDGIVCVSGDG
ILVEVINGLLRRDDWVDAIKTPLGVVPAGTGNGMVKSLLHSIGDPCTACNATLAIVRGHK
CSLDVATISQGEAKHFTVLMLAWGLVADIDIESEKYRWMGSARLDIYALQRIISLRHYRG
GVSFVPAPGFEDYGEPTRYDYETASVVEVDKSDGEPISIQRHGYEGPNINLKDLEWRKFD
GPFISVWLHNVPWGAENTLAAPDAKMSDGFLDLIIIRDCSKLSLLSLMTELNNGKHVKSP
FVTYIKVKAFILKPGTRVKEPSKEGIIDADGEILALGKGTLTTSQKTLMNYDELLISVHQ
GLATLFSPCRN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatccggggactcagacttcatcctcaaccaccgtgttcttcttccagacgga
accgtcacgccgatgattcttactaccgacggttggcttcagtggtcggagaaaagtcaa
cggcgtttgtccgttgataaggaggttcttggattctctatggatggtccgaagattagg
atcaaagctcttgtggaggaccatggtggattgcggtgttttggaagcagcggagctttg
gtgaggaaggagtttgtatttcagcctctttccgaggagtcacgggcgctttggtgtctg
aagcttcgtgaatgcatcgatttgattggtcgcccaaaaaagctgtttgttctcgttaac
ccatttggtgggaaaggaactggttccaaaatttatcgagatgaagtgaagcccattctc
gaggatgccgaaatcgacgtcacactgcaagagactaaatatcagcgccacgcagaggag
gttgcttattcattggattttactaattacgatggcattgtttgtgttagtggtgatgga
atcttggtagaggtaataaacggattgctgaggagagatgattgggttgatgcaattaag
acgcctttaggagtagtacctgcaggcactggaaatgggatggtgaaatcacttcttcat
tcaatcggtgacccttgtacagcatgcaatgctactcttgccatcgttcgaggccataaa
tgttcattggatgttgccaccatttcgcaaggagaggctaaacattttaccgtgttgatg
cttgcttggggattggtggcagatattgacattgagtcggaaaaatataggtggatggga
agtgctcggttagatatttatgctctccaacgaattataagtttgaggcactacagagga
ggtgtttcttttgtgcctgcacctggatttgaagattatggagagccgacaaggtatgat
tatgaaactgctagcgtagtagaggttgacaaaagtgatggtgagcccattagtattcaa
cggcatggctacgaaggacctaatatcaacttgaaggatttagaatggagaaaatttgac
ggaccttttatttcagtctggcttcacaatgtaccttggggagctgaaaacaccttggca
gcgccagatgctaagatgtcagatggcttcttggacttaataattatcagagactgctca
aaattatccttgctgtcgttgatgactgagttaaataatggaaagcatgtgaagtctcca
tttgttacgtatatcaaggtcaaagcatttattttgaaacctggcacacgggtaaaggag
ccaagcaaagaaggaattatagacgcagatggtgaaatcttagctttggggaagggaact
ctcacgactagtcagaaaactcttatgaattatgatgaacttctaatcagcgtacatcaa
gggttagccactctattttccccctgtaggaattga

DBGET integrated database retrieval system