KEGG   Cucumis sativus (cucumber): 101206269Help
Entry
101206269         CDS       T02486                                 

Definition
(RefSeq) probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00020  Citrate cycle (TCA cycle)
csv00640  Propanoate metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101206269
   00640 Propanoate metabolism
    101206269
Enzymes [BR:csv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101206269
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101206269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 101206269
NCBI-ProteinID: XP_004137529
UniProt: A0A0A0LQL7
Position
1
AA seq 342 aa AA seqDB search
MGRQAVAKLIGSAINRKTSSSSSSSSVFSRAASQIRHYSAAPSPPPAVFVDKNTRVICQG
ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPP
PFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECK
IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEK
FLVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPIVGFIAGLTAPPGRRMGHAGAIVS
GGKGTAQDKIKTLREAGVTVVESPAKIGVSMLEVFKQRGLVS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtcaagctgttgccaagctcatagggtcggccattaatcgcaaaacttcttca
tcttcatcatcatcttctgtgttttcgcgtgcggcgtcgcagattcggcattactccgct
gctccgtcacctccaccggcagtttttgttgataagaacactcgcgttatatgtcaaggg
atcactggtaaaaacggtacatttcacacagagcaggccatcgaatatggcaccaaaatg
gttggtggtgtaacgccaaagaagggtggaacagaacacttggggcttcctgtttttaac
tcagttgctgaagccaaagctgaaaccaaggccaatgcatcagttatttatgttcccccg
ccatttgctgcagcagctatcatggaggcaatggaagctgagttagatcttgttgtttgt
attacggaagggatcccacaacatgatatggtgcgagttaaggctgctttaaacaaacaa
tctaaaactagattgattggccctaattgccctggcattatcaagcctggagaatgtaaa
atcggaattatgcctggatacatccacaaacctggtcgcattggcatagtatcacgatct
ggtaccttgacttatgaagctgtttttcaaacaactgctgttggccttggacaatccact
tgcgtaggtattggaggggatccctttaatgggacaaactttgttgattgtatcgagaag
ttccttgttgatcctcagacagaaggtattgttctaattggagaaataggtggaactgct
gaagaggatgctgccgctttgattaaggaaagtgggactgataagcctattgttggattc
attgctggcctaactgctcctccaggccgtcgcatgggtcatgctggcgccattgtctca
ggtggaaaaggaacagcccaagacaaaatcaagacactacgagaagctggagtaacggtg
gtcgagtcacctgcaaaaattggtgtgtcaatgcttgaagttttcaaacagagaggcctc
gttagttag

DBGET integrated database retrieval system