KEGG   Cucumis sativus (cucumber): 101207286Help
Entry
101207286         CDS       T02486                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    101207286
Enzymes [BR:csv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     101207286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth ANTAR
Motif
Other DBs
NCBI-GeneID: 101207286
NCBI-ProteinID: XP_011652724
Position
3
AA seq 546 aa AA seqDB search
MAYEEIIAANNGCFDDGVLRRAAEFPPSPWGDVLSFHFNNHLVEDSVVEKQQFQEVKEEL
RSMFAAAENSSKRLSLIDSIQRLGLSHHFQEEINEVVLEQIEKLRKVNDEDADENLYLVA
LRFRLLRQQGYYVSCGKSSSNNSFKELISSHLRTKGENILDEALAFTTTHLKAMAMDSNS
PFFEEAKYALKWPIYKAVPRFMARQYISLYHNNPLKNNNVLLTFAKLDYNSLQKLYHKEL
GEFSRWWKDHKLKELLPFARVRVVEIYVWALGIQYEPKYSNTRRILVKIITFISLLDDMY
DVYATLDELQLFTNAIQRWDVSCIEKLPNYMKGLYETVLEVYEEIEQDISKDNNIPFAFD
YAKEAMKSLCKAYFMEAKWFNEGYVPKVEEYMKVASISASYNVFASISFLSLGNVASKEV
YEWAQTQPILLKATGVMGRLLNDIVSHKFEQERGHVASAVECYMKEYGVSEEEAIIELEK
EVGTAWKDVTEDYTKFSLKLPNVILECVLNVARISDFFYKKVDGYTFADEETKHFIDLML
THPVPT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgaagaaattatagcagcaaataatggatgtttcgatgatggtgttcttcgt
cgagctgcagaatttccgccaagtccttggggagatgttctttcctttcatttcaacaat
cacctggttgaagatagcgtggtggagaaacaacaattccaagaagtgaaagaagaactg
agaagcatgtttgcagctgctgaaaattcttcgaaaagactaagtttaattgattcaatc
caacgtttaggtctttctcaccactttcaagaagaaattaatgaagttgttcttgaacaa
attgaaaagcttagaaaagttaacgacgaggatgctgatgagaacctttaccttgttgct
cttcgatttcgattgcttagacaacaaggttactacgtttcatgtggtaaaagttcctca
aacaattctttcaaagaattaatttcatcccacttgagaacgaagggagaaaatatattg
gatgaagcattagctttcacaactactcatcttaaagcaatggccatggattccaattct
ccattcttcgaggaagccaaatatgcattgaagtggccaatttataaagctgtgccaagg
tttatggctaggcaatatatctctctttatcacaacaatccattgaagaataataatgtt
ctgctcacttttgcaaagttggactacaattctctccaaaaactttaccacaaagagttg
ggtgaattttcaaggtggtggaaagatcacaagttgaaggagctattaccttttgcacga
gttagagtggtggagatctatgtttgggcattgggaattcaatatgaaccaaagtactct
aatactagaagaatattagtcaaaattattacttttatatctcttcttgatgatatgtat
gatgtctatgccacacttgatgaacttcaactattcaccaatgccattcaaaggtgggat
gtgagttgcattgagaagctcccaaattacatgaaaggactttatgaaactgtacttgaa
gtttatgaagagattgaacaagacatttccaaggataataatattccgtttgcgtttgac
tatgcaaaagaagcgatgaaaagtctatgcaaagcttactttatggaggctaaatggttc
aatgaaggttatgtaccaaaagtggaagaatatatgaaagttgccagcatttctgcttcc
tataatgtttttgcttcaatttctttcctttctttaggaaatgttgcttcaaaggaggtt
tatgaatgggctcaaactcagcctattcttcttaaagcaactggtgtaatgggcaggctt
ctcaatgacatagtttctcacaagtttgaacaagagcgaggacacgtggcttctgcagtg
gaatgttacatgaaagaatatggagtatcagaagaagaagccataattgaattagaaaag
gaagttggaacagcatggaaagatgtgacagaagattacacaaaattttcgttgaagctc
ccaaatgtgatccttgaatgtgtgttgaatgttgcaagaatttcagatttcttttataag
aaagtagatggttacacatttgctgatgaagaaaccaaacattttattgacttaatgctt
actcaccctgttccaacttga

DBGET integrated database retrieval system