KEGG   Cucumis sativus (cucumber): 101209132Help
Entry
101209132         CDS       T02486                                 

Gene name
GDH, HPR, hpr-A
Definition
(RefSeq) glycerate dehydrogenase-like
  KO
K15893  glycerate dehydrogenase [EC:1.1.1.29]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00260  Glycine, serine and threonine metabolism
csv00630  Glyoxylate and dicarboxylate metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Module
csv_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101209132 (GDH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101209132 (GDH)
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     101209132 (GDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AlaDh_PNT_C NAD_binding_2 Fibrillarin NAD_Gly3P_dh_N Peripla_BP_2 Dzip-like_N F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 101209132
NCBI-ProteinID: NP_001267567
UniProt: P13443 A0A0A0K5Z2
Position
7
AA seq 382 aa AA seqDB search
MAKPVQIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTEKKTILSVEDILALIG
DKCDGVIGQLTEDWGEVLFSALSRAGGKAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLT
ETTAELAASLSLAAARRIVEADEFMRAGRYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAY
ARMMVEGFKMNLIYFDLYQSTRLEKFVTAYGEFLKANGEAPVTWRRASSMDEVLREADVI
SLHPVLDKTTFHLVNKESLKAMKKDAILINCSRGPVIDEAALVDHLRDNPMFRVGLDVFE
DEPYMKPGLADMKNAIIVPHIASASKWTREGMATLAALNVLGKIKGYPVWSDPNRVEPFL
DENVSPPAASPSIVNAKALGNA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaccagttcaaatcgaagtatggaatccaaatggaaagtacagagttgtcagc
actaagcctatgcctggaactcgctggatcaatctcttgatcgaacaagattgccgagtc
gaaatttgtactgagaaaaagacgatactctcggttgaggatattcttgctctcatcggc
gataagtgcgacggcgtcattggacagttgactgaagattggggagaggtgctgttttct
gcgttaagcagagcgggagggaaagcttttagtaatatggctgttggttacaataatgta
gatgttaatgctgctaataagtacggtgttgctgtaggaaatactcctggagtacttaca
gagactacagcagagttggcagcttcactttctcttgcagctgcaagaaggatagttgaa
gcagatgagtttatgagggcaggtcgatatgatggatggcttccaaatttgtttgttggg
aacttgctgaaaggacagactgttggtgtgattggagctggtcgtattggatctgcttat
gcaagaatgatggtagaagggtttaagatgaacctgatctacttcgatctttaccagtca
actagactcgaaaagttcgttacagcctatggtgagttcctgaaagccaacggtgaggct
cctgtgacatggagaagagcatcatcaatggatgaggtgcttcgagaagcagatgtgata
agtcttcatcccgtactggataaaactaccttccatcttgtgaacaaagaaagtcttaaa
gcgatgaagaaggatgcaattctcattaactgcagtaggggacctgtgatcgatgaagca
gcccttgttgatcatttgagagataatcccatgtttcgagttggccttgatgtttttgag
gatgaaccatacatgaaacctggacttgctgatatgaagaacgcgatcattgttcctcac
attgcttctgcttccaagtggactcgcgaaggaatggcaacactggctgctcttaatgtc
ttgggaaagattaaaggatatcctgtttggtccgatccaaaccgagtagaaccgttcctc
gacgagaatgtttcacctccagctgcatcacctagcattgtgaatgccaaagccttgggt
aacgcctaa

DBGET integrated database retrieval system