KEGG   Cucumis sativus (cucumber): 101209855Help
Entry
101209855         CDS       T02486                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
csv  Cucumis sativus (cucumber)
Brite
KEGG Orthology (KO) [BR:csv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101209855
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     101209855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_8 EF-hand_1 NAD_binding_7 Pyr_redox_3 Katanin_con80 EF-hand_5 DUF1858
Motif
Other DBs
NCBI-GeneID: 101209855
NCBI-ProteinID: XP_004139962
Position
6
AA seq 585 aa AA seqDB search
MRWNTFYTKASNLFHDHPSISKLLIVFTLSGGGLVATTNGRSLYHSVYADAVQQDGYWKK
KKVVVLGTGWAGTSFLKNLKSSSYDVHVISPHNYFAFTPLLPSITCGTVEARSIVEPIRS
ITKKKGLDIEFREAECYKIDAEKKMVFCRSSQDTNLGGREEFSVDYDYLIIAMGAKSNTF
NTPGVEENAHFLKGVEDAQRIRQTVIDCFERASLPNLSEEEKKRTLHFVIVGGGPTGVEF
AAELHDFAVEDLAALYPSLKDYVKITLLEAGDHILNMFDKRITAFAEEKFQRDGIELKTG
SMVVKVTDKEISTKESATGEFVSIPYGMVVWSTGIGPRPQVIDFMNQIGQTNRRALATDE
WLRVEGCDGVYALGDCATVNQRRVMEDISVIFSKADKDKSGALALQEFQEVVGDICERYP
QVGIYLKKKQMKNFAALLKKTQSDTQKQSTELDIESFKSLLSEVDSQMKNLPATAQVAAQ
QGEYLASCFSRMDQCEKYPEGPLRFRGTGRHRFHPFRYKHFGQFAPLGGEQTAAQLPGDW
ISIGHSTQWLWYSVYTSKLVSWRTRILVISDWGRRFVFGRDSSRI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggaatacattctacaccaaagcttctaatctttttcatgatcatccttccatc
tctaagcttctcattgttttcactctcagtggaggtggactggtagcaactactaatggc
agatctctgtatcactctgtgtatgccgatgcagtccaacaagatggttactggaagaag
aagaaagtagtggtgcttggaacaggatgggctggcaccagttttttgaagaatctcaag
agttcatcttatgatgttcatgttatttctcctcataattactttgcttttacccctttg
cttcctagtatcacgtgtggcacggttgaagctcgcagcattgttgaaccaattcgtagt
attacaaagaagaaaggtctggatattgaatttagggaagctgagtgctataagattgat
gcagagaaaaagatggtattctgtagatcaagtcaagacacaaatttgggtggcagagaa
gaattttctgttgattatgactatctgattatagccatgggagccaaatccaacactttc
aacacacccggagttgaggaaaatgctcacttcttgaagggagtggaagatgctcagagg
attcgtcagaccgtaatcgattgtttcgagagagccagccttccaaatctaagtgaagaa
gagaagaagagaactcttcactttgtaatagttggaggtggtccaactggagtggaattt
gcagcagagcttcatgactttgcagttgaggatttagcagcattgtatccttcattgaaa
gactacgtgaaaataaccctcttagaggcaggagatcatattttgaacatgtttgacaag
agaattactgcctttgctgaagaaaaatttcaaagagatgggattgaactaaaaactggt
tccatggtcgtaaaagtaactgacaaggaaatctccacaaaagaaagcgcaaccggtgaa
tttgtatccattccttatggaatggttgtctggtctaccggcataggccctcgtcctcaa
gtcattgatttcatgaatcagattggtcagactaacagaagagctttggcaactgatgag
tggctaagggttgaaggatgtgatggtgtctacgctcttggtgattgtgccactgtaaat
caaagaagagtcatggaagatatttcagtaatattcagtaaggcagacaaggataagtca
ggagctttagccctgcaagagtttcaagaagtggtaggtgacatttgtgagaggtaccct
caagttgggatctatctgaagaagaagcagatgaagaactttgcagctttgttgaagaag
acacaatcggacacacagaaacagtcgactgaactggatattgaaagctttaagtcctta
ctttctgaagttgattctcagatgaaaaatctccctgctactgctcaagttgctgctcaa
caaggtgaatatcttgcaagctgcttcagccggatggatcaatgtgaaaagtaccctgaa
ggccctctccgatttcgagggacaggacgccacaggtttcatcccttcaggtacaagcat
tttgggcagtttgctcctcttgggggagaacaaactgcagctcaactacctggagattgg
atctcaattggtcatagcacccagtggctttggtattctgtttataccagcaagctagta
agttggcgcacaaggattctggtcatttcagattggggtagaagatttgtgtttggcagg
gattcaagcagaatctga

DBGET integrated database retrieval system