KEGG   Cucumis sativus (cucumber): 101211107Help
Entry
101211107         CDS       T02486                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00480  Glutathione metabolism
csv00590  Arachidonic acid metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101211107
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101211107
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101211107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 101211107
NCBI-ProteinID: XP_004145493
UniProt: A0A0A0L112
Position
4
AA seq 241 aa AA seqDB search
MSLSATFPAPIYVCSKTSTRFCYSFASWPSMAANLIPSLKSSLAASKSPFLRHNLTMQSS
ISRGVFSKARFSGVSARAATEKSIYDFTVKDIDGKGVSLNKFKGKVLLIVNVASRCGLTT
ANYSELSHLYEKYKAQGLEVLAFPCNQFGGQEPGSNPEIKQFACSRFKAEFPIFDKVDVN
GPNTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLVA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatccgctactttcccagctccaatctatgtctgctcgaaaacctcaacacgt
ttctgctattcctttgcttcatggccttccatggccgctaacttgattccttcactcaaa
tcctcgcttgcagcttccaaatcgccttttctgcgccataatttgactatgcagtcctca
atttctcgtggggtgttttcgaaagctcgattttctggtgtttctgctagagctgctacg
gagaagagtatttacgatttcactgttaaggatattgatggcaaaggtgtttcactgaac
aagttcaaagggaaggttcttctgatagtaaacgttgcatctagatgtggcttgactact
gcaaactactcagaactgtcacacttgtatgagaaatacaaagctcaagggctagaggtt
ttggcttttccttgcaaccaatttgggggccaagaacctgggtccaatccagaaatcaag
cagtttgcctgctcaaggttcaaggccgagttcccaatttttgacaaggttgatgtcaat
ggtccaaatactgccccagtatatcagtttcttaaatcaagtgctggagggtttttaggt
gatcttatcaaatggaactttgagaaatttttggtggacaaaaatggtaaagttgttgag
agatacccaccaacaacatcgccttttcaaattgagaaggatatccaaaagcttgttgct
gcctaa

DBGET integrated database retrieval system