KEGG   Cucumis sativus (cucumber): 101211366Help
Entry
101211366         CDS       T02486                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 1-like
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00562  Inositol phosphate metabolism
csv01100  Metabolic pathways
csv04070  Phosphatidylinositol signaling system
Module
csv_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101211366
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101211366
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     101211366
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     101211366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 101211366
NCBI-ProteinID: XP_004148764
UniProt: A0A0A0L3W9
Position
3
AA seq 363 aa AA seqDB search
MEGRRFCIGYALAPKKRHSFIQDSLVTLAASRGVDLVRIDTDRPLLDQGPFDCILHKFYG
EDWRKQLMEFRVKNPNAFILDSPDSIERLHNRISMLQVVSELKIDNPDESFGIPKQIVIY
DKETLFDRQAWEGLKFPVIAKPLVADGSAKSHKMALVFNHDCLNKLKPPIVLQEFVNHGG
VIFKVYVVGQYVKCVKRKSLPDEPEAKLGNVDGLLSFSQVSNMTPREKIDDKHYMMQLDD
TEMPPLSFVTDIARGLRRSMNLNLFNFDVIRDSKIGTRYLIIDINYFPGYAKMPGYEKVL
TDFFCDLAQKKEALNNPDKKKDVEDKIVLDLQSTDQQTRKIGNDEIGGGQSVEREKKGTP
VQD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaggacgtagattttgtataggttatgctttggctcccaagaaacgtcatagtttc
attcaagattcgttagtgactcttgcggcgtctcgaggggtcgatcttgttcgaattgac
actgaccggcctcttcttgatcaaggcccatttgattgtattcttcacaagttttacggc
gaggattggaggaagcaactgatggaattcagagttaagaaccctaatgctttcattttg
gattcacccgattcgattgagagactccacaaccggatttcgatgcttcaggttgtttcc
gagttgaagattgataaccctgatgaatcttttgggattcctaagcagattgtgatttac
gataaggagactttgtttgatcgccaggcttgggagggtttgaaattccctgttattgct
aagccattagtggctgatggtagtgctaaatctcacaaaatggctcttgtattcaaccat
gattgtttgaataagcttaagcctcctattgtcttgcaggagtttgtgaatcatgggggt
gttatctttaaggtttacgttgttgggcagtatgtgaaatgtgtgaaaaggaagtctctt
cctgacgaacccgaagcaaaactggggaatgtagatggattgttgtcgttttcgcaggtc
tcaaatatgacccctcgtgagaaaattgatgataagcactacatgatgcagcttgatgat
acagagatgccaccgttgagttttgtcaccgatatcgcaagagggttgcgacgctccatg
aacttgaatcttttcaactttgatgtgattcgggactcgaaaattgggactcggtacctt
ataattgacattaactacttccctgggtatgccaaaatgccaggttatgagaaagttttg
acagatttcttctgtgatctagcacagaagaaagaggcattgaacaatcctgacaagaag
aaggatgttgaagacaagattgttttagatttgcagagtactgatcaacaaacaagaaag
attggtaatgatgagattggtggtgggcagtcagttgaaagggaaaagaaaggaacccct
gttcaagattga

DBGET integrated database retrieval system