KEGG   Cucumis sativus (cucumber): 101211867Help
Entry
101211867         CDS       T02486                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00450  Selenocompound metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101211867
Enzymes [BR:csv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     101211867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 MTS Methyltransf_31 PrmA Methyltransf_25 Met_10 Methyltransf_32 Methyltransf_12 Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 101211867
NCBI-ProteinID: XP_004133738
UniProt: A0A0A0L5H2
Position
3
AA seq 1084 aa AA seqDB search
MASVLDSVDSFLALCQQSGDAAYAALRSLLDRLEDPATRVRARVFLADVQRRFPTKDDCD
RCFSSYHFRIEDIFLDQYEGYRGRKKLTSMVIPSIFVPEDWSFTFFEGLNRHPASIFKDR
TVAELGCGNGWISIAIADKWLPLKVYGLDINPRAVKVSWINLYLNALDEKGQPIFDGEKK
TLLDRVEFHESDLLAYCRDNDIQLERIVGCIPQILNPNPDAMSRMITENASEEFLYSLSN
YCALQGFVEDQFGLGLIARAVEEGISVIKPMGIMIFNMGGRPGQGVCKRLFERRGFRITK
LWQTKILQAADTDISALVEIEKNSPHRFEFFMGLSGDQPICARTAWAYGKAGGRISHALS
VYSCQLLQPNQVKTIFDFLKSGFQEISSSLDLSFQDDSVADEKIPFLAYLASILKDSAYF
PYEPPAGSLRFRNLIAGFMKTYHHVPVSAGNVVIFPSRAVAIENALRLFSPRLAIVDEHL
TRHLPRQWLTSLNIDTGVNGAGDDVLTVIEAPSQSDLMMELIKKLKPQVVVTGMAHFEAV
TSSAFVHLLDVTREIGSRLFLDISDNFELSSLPSSNGVLKYLAGNSLPSHAAIVCGLVKN
QVYTDLEVAFVISEEEAIFKALSKTVELLEGKTAPISQYYYGCLFHELLAFQLADRHLPA
QRECDKSASSREIIGFSSSAISVLNNAELSIDQTDNSSLIHMDVDEIFLPTPISVKAAIF
ESFSRQNMSESEIDVTTSVKQFVKSNYGFPIENNSDFIYADSALTLFNKMVLCCIQEGGT
ICFPVGTNGNYVHSAKFLKAKVVNIPTRSEDGFKLTENALNQVLNNVKNAWVYISGPTIN
PTGLIYDQKEIENLLTACSKFGARVIIDTSFSGLEFDYESWSGWNLEGVLSRLCQSNNPS
FSVCLLGGLSPMMLTDALKFGFLVLNQPPLIELFHSFSGLSRPHSTVKYAIKKLLGLRVR
KSGDMWDAVTRQIKDLRSRSKRLKETLESCGWDVIECHAGVSVVAKPTLYMSKTVRVKNA
IDYEVKLNDSNIREAILKATGLCINSSLWTGIPGYCRFTIALEESEFQKALDCIADFKRI
ACSS
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgttttggactctgttgatagtttcttagccctctgtcagcagtccggcgat
gctgcttacgccgccctccgttcccttctcgaccgtcttgaggatcctgctaccagagtc
cgagctcgtgttttcctcgccgatgtccagaggcgttttcctactaaggatgattgcgac
cgctgcttctcctcctaccatttccggatcgaggatatttttctcgaccaatacgaagga
tacaggggtaggaagaaattgacgtcaatggtaatccctagcattttcgtcccagaagat
tggtcatttactttctttgagggattgaataggcatccagcttccatctttaaggatcga
acagtggcggaacttggttgtgggaatgggtggatatctatcgccattgctgataaatgg
ttacctttgaaggtctatggcctcgacatcaaccctcgagcagtaaaggtttcttggata
aatctgtatttaaatgcattggatgagaagggccaaccaatttttgatggtgagaagaaa
acccttttggatagagtagagttccatgaatctgatctactggcctattgtagagacaat
gatatccaacttgagcgaattgttggatgcatacctcagattcttaacccaaatccagat
gctatgtccaggatgataacagaaaatgcaagtgaggaatttttgtactcgttgagtaac
tattgtgcacttcagggctttgtcgaagatcagtttggtttaggtctgattgctagggca
gtagaggaaggaataagtgttatcaaacccatggggattatgatcttcaatatgggaggt
cgtccaggacaaggtgtttgtaagcgattatttgaacggcgtggtttccgcattaccaag
ctttggcaaacaaaaattcttcaggcggctgacactgacatctctgccttggttgaaatt
gagaagaacagtccacatcgttttgagttttttatgggactttcaggggatcaacctatt
tgtgctcgaacagcctgggcatatgggaaggctggtggtcgcatctctcatgcattatca
gtttatagctgtcaactccttcagccaaatcaggttaagacaatatttgattttcttaag
agtggattccaagaaatcagcagttcattagatttatcatttcaagatgattccgttgct
gatgagaagattccatttctagcttatcttgccagtatattgaaagacagtgcatatttt
ccatatgagccaccagctgggagcttgcgtttccgaaaccttattgctggatttatgaaa
acataccaccatgtaccagtcagtgctggaaatgttgtgatctttccatcaagggctgtg
gccatcgagaatgctcttcgcttgttctcccctcgccttgccattgtggacgaacatcta
acccggcacctaccaaggcaatggttaacttcactcaatattgataccggagttaatggt
gctggagacgatgtacttacggttattgaggccccaagccagtcagatttgatgatggag
ctgataaagaaactgaaacctcaggtggtggtgactgggatggctcattttgaagctgtt
actagttctgcttttgtgcaccttttggatgttaccagagaaataggttcccgacttttc
ttagacatatctgacaattttgaactttccagtcttccaagttccaatggagtcctaaag
tatctagcaggaaattctcttccttctcatgcagctattgtgtgcggcttggtgaaaaat
caggtatatacagatttagaagtggcttttgtaatttctgaagaagaagccatttttaag
gccttgtccaaaactgtagaattgttagaagggaaaactgcccccataagtcaatattac
tatggctgcctttttcacgagctacttgcttttcagctagctgaccgccatctacctgca
cagagagaatgtgacaaaagtgcaagctcaagagagataattgggttttccagttctgcc
atctcagttctcaataatgctgagctgtcgattgatcagacagataattcttccctgatt
catatggatgttgatgagattttcttgcctacaccaatttcagtcaaagctgctattttt
gaaagtttttcaagacagaacatgtctgagtcagaaatagatgtcacaactagcgtcaag
caatttgtcaaaagcaattatgggttcccaatcgaaaacaattcagacttcatatatgct
gatagtgcactgacattgtttaataagatggttctctgttgcatccaagaaggtggaaca
atatgttttccagttgggaccaatggtaactatgttcacagtgccaaatttttgaaggca
aaagttgtaaacatacctaccagatctgaagacggattcaagttaacagagaatgcactt
aatcaagtactcaataatgtgaaaaacgcatgggtatacatatctggaccaacaattaac
ccaactggtctgatttatgaccagaaagaaatagagaatttattaactgcttgttctaaa
tttggggctagggtcatcattgatacttcattttcaggattggaatttgattatgagagt
tggagtggctggaatctggaaggggttctatcgaggctttgccaatctaacaatccatcg
ttttctgtatgtctgcttggaggactatcaccaatgatgctaacagatgccctcaaattt
ggtttcctggttttgaaccaaccgcctttgattgaattgttccatagcttctcaggatta
agtagacctcatagcacagtgaaatatgctataaagaagttgctaggactaagagtgagg
aaatcaggagacatgtgggatgctgtaaccagacagattaaggacctgagaagtagatcc
aagcgtctgaaagagacacttgagagctgtggatgggatgtgattgagtgccatgccggt
gtctccgtagtagccaagcccacactttatatgagcaagacagtccgagtgaaaaacgcc
attgattacgaagtaaaacttaacgactcaaatatcagagaagcaattctgaaggccact
ggtttatgcatcaacagcagcttatggacaggaatccctgggtactgccggttcacaatt
gcattggaggaaagtgagtttcaaaaggctctggattgcattgccgacttcaaaagaatt
gcgtgctcctcgtag

DBGET integrated database retrieval system