KEGG   Cucumis sativus (cucumber): 101212302Help
Entry
101212302         CDS       T02486                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyanogenic beta-glucosidase
Organism
csv  Cucumis sativus (cucumber)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 101212302
NCBI-ProteinID: XP_011660115
Position
1
AA seq 540 aa AA seqDB search
MDPIIMPNIKRSNFPRNFVVGCASSAYQYEGAAFKYGRGPSIWDTYTHQHPERIDDGSNA
DVAVDQYHRYREDVGIIKGIGFDAYRFSISWSRVLPSGKLSGGVNQEGIDYYNRLIDELI
SKGIKPYVTLFHWDVPQALEYIYQGFLGQQIIDDYRDFADLCFKEFGDRVKHWITFNEQY
IFAAYGYATGLFAPGRGSSQQVDCFDGDTGTKKSNHIGLLPRRGCILKPLHSLGGDPGTE
PYIVGHHQILAHAKAVKLYKSKYKHQNGQIGVTLNTDWYVPYSNSLEDKKATSRALDFSL
GWFLHPLVYGDYPASMRHLVNKRLPKFKDDEILLVKGSYDFIGINYYTANYAKNNPNVDP
HKPSLVTDPHADVSTDRDGVPIGPKVSKDSWLAVYPQGLKDLMIHIKNHYRDPHILITEN
GFFDYNCSNIEKLIKDEGRVKYHQQHLTKLHESIKAGVNIKGYFAWTLLDDFEWSRGYTM
RFGITYIDFKHKTLERIPKYSXKVVQPFPTHLKIFTTNPSKLFAKPIIVKIPSKLFAMAL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggatcctattatcatgcccaatataaagagaagcaacttccctagaaactttgttgtt
ggttgtgcatcatctgcttatcaatacgaaggtgctgcttttaagtatgggagaggacca
agtatttgggatacgtacactcatcaacacccagagagaattgatgatggcagtaatgct
gatgtagctgttgatcaatatcatcgctatcgggaagatgttggcattattaagggtata
ggttttgatgcctacagattctcaatttcctggtccagagtcttgccatcgggaaagctt
tctggaggtgtgaatcaagaaggaattgactactacaatagactcatcgatgagctcatt
tcaaaaggcatcaaaccatatgtgacacttttccattgggatgttccccaggctttagaa
tatatatatcaaggcttcttgggtcaacaaattatagatgattatcgagattttgctgac
ctttgcttcaaagagtttggagatagagtgaaacattggatcacttttaacgaacaatat
atctttgccgcatatggctatgcaactggactatttgcaccaggcagaggatcttcgcaa
caggttgattgtttcgatggagatactggaactaaaaaatcaaaccatattggtctttta
ccacgtagaggctgtattttgaaaccgttacatagtctcggtggagaccctggaactgaa
ccatatattgttggtcatcaccaaattctcgcacatgctaaggcggttaaactttacaag
tctaaatataaacatcaaaatggtcaaattggggtgacattgaatacggattggtatgtc
ccatattcaaatagtttggaagacaaaaaagctacatctcgagctcttgatttttctctt
ggttggtttttgcatcctttggtgtatggagattatccagccagcatgagacatcttgtg
aacaagagattgcctaaattcaaagatgatgaaattcttttggtgaaagggtcttatgat
tttattggaataaattactatacagctaattatgcaaagaataatcccaatgttgatcct
cacaaaccaagtctagtgactgatccccatgctgatgtttcaactgatcgagatggagtt
ccaattggtccgaaggtgagtaaagattcttggcttgcagtttatccacaaggattgaaa
gatcttatgatacatataaagaaccattacagagatccacacatcctcattacagaaaat
ggatttttcgactataattgttccaacatcgagaaattaatcaaggatgaaggcagagtt
aaataccaccaacaacatctcactaaacttcacgagtcaataaaggctggagtaaatata
aaaggatattttgcatggacattattggacgattttgaatggtcgagaggatatactatg
aggtttggtataacctacattgatttcaaacacaaaactttggaacgaatcccaaaatat
tcangcaaggtggttcaaccatttcctacgcacttgaagatattcacaaccaacccctcg
aagctatttgctaaacccattatagtaaagatcccctcaaagctatttgctatggcatta
taa

DBGET integrated database retrieval system