KEGG   Cucumis sativus (cucumber): 101212627Help
Entry
101212627         CDS       T02486                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00970  Aminoacyl-tRNA biosynthesis
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101212627
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:csv03029]
    101212627
Enzymes [BR:csv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     101212627
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     101212627
Mitochondrial biogenesis [BR:csv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101212627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 101212627
NCBI-ProteinID: XP_004140137
UniProt: A0A0A0KEN8
Position
6
AA seq 550 aa AA seqDB search
MLSTLQPPRCSLSRFTLHLPSKPSFFHSKQTPLSTPHSTLTDQLPTSNSSQPLQSQILSI
RHSLLSRQITATQLADSYLNRLRALEPHLKSFLHVSETVRSDAREIDDKILRNEELGPLA
GVLVAVKDNICTAGMPSTAGSRILDGYRPPFDATAVKRIKELGGIVIGKTNLDEFGMGSS
TEASAFQVTANPWDLSRVPGGSSGGSASAVSARQCVVSLGSDTGGSVRQPASFCGVVGLK
PTYGRVSRFGLMAYASSLDVIGCLSTTVADAGILLHSISGHDTLDATSSKREVSDFTSQF
SAVDSFESKPLRGLRIGLIRETLDKGVDGQVNSAIRAAASHLEELGCSINEVSLPSFSLG
LPAYYILASSESSSNLARYDGVRYGNQAIADELTGLYENSRATGFGSEVKMRILMGTYAL
SAGYYDAYYKRAQQVRTIIQKSFRAALDEYDILISPTAPSAAYKIGEKVDDPLAMYAGDI
MTVNVNLAGLPALVLPCGFVQDGSSNLPVGLQMIGAAFDEGKLLKVGHIFEQTLADCRFV
PPLLADDIVG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgctatccacactgcaaccccctcgctgctctctctctcgattcactctccatcttccc
tccaaaccttccttctttcactccaaacaaaccccactttcaactccacattccactctt
acagaccaacttcccacttccaattcttcccaaccccttcaatcccaaattctctccatc
cgccattcacttctttcccgccaaatcactgccacccaactcgccgactcctatctcaat
cgccttcgtgctttggagcctcacctcaagtcatttctccacgtctctgaaactgtccgc
tctgatgcccgtgagattgatgacaaaattctcagaaatgaggaactgggtcctttagct
ggggtgcttgtggccgttaaggacaatatttgtactgcgggtatgccttccactgctggg
tctcggattcttgatggatatcgcccaccatttgacgctactgctgtgaagagaatcaag
gagttgggtgggattgtgattgggaagactaatttggatgaatttggcatgggtagctct
actgaagcctctgctttccaggtgactgcaaatccgtgggatttgagtagggtcccggga
ggatcatcaggaggatctgcttcagctgtttctgctaggcagtgtgtggtgtcattggga
agtgatacaggtggaagtgtgcggcagccagcatctttttgtggtgttgttgggttgaaa
ccaacatatggtcgtgtctcaagatttggacttatggcctatgcttcttcgcttgatgtt
attggctgcttgagtacaacagttgctgatgctgggattcttctacattcaatttctggt
catgatacccttgatgccactagtagtaaacgagaggtttctgatttcacatcacaattt
tctgccgttgattcattcgaatctaaacccttgagaggattgaggattggcctgattcgt
gaaacccttgataagggtgtcgatggtcaagtaaattctgctatacgtgctgctgcttca
catctagaagaattaggatgttccatcaatgaggtatcactaccatcattttctcttggg
ctgccagcgtattatattcttgcatcatctgaatcatcttcaaacttagcacgatatgat
ggtgtcagatatggaaatcaagctattgctgatgagctaactggtctatatgaaaattcc
cgagcaacaggatttggttcagaggttaaaatgagaattttgatgggaacatatgctctc
tcagctggttattatgatgcttactacaagcgtgctcagcaggtgagaacaattatccag
aaaagcttcagagcagcactagatgaatatgacatcttaatatcacctactgcaccatct
gccgcttataaaattggtgaaaaggtggatgacccattggcaatgtatgcaggtgacatc
atgactgtcaatgttaacttggctggactacctgcattggtattgccttgtggatttgtt
caagatgggtcctctaaccttcctgttggccttcaaatgattggtgcagcttttgatgag
ggcaaacttcttaaagtgggacacatcttcgaacaaactcttgccgactgcagatttgtt
ccacccttactagctgacgacattgtaggttag

DBGET integrated database retrieval system