KEGG   Cucumis sativus (cucumber): 101213181Help
Entry
101213181         CDS       T02486                                 

Definition
(RefSeq) protoporphyrinogen oxidase, chloroplastic/mitochondrial
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00860  Porphyrin and chlorophyll metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Module
csv_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101213181
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101213181
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     101213181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 HI0933_like Pyr_redox_2 Thi4 FAD_binding_3 AlaDh_PNT_C Pyr_redox FAD_oxidored Pyr_redox_3 FMO-like IlvN 3HCDH_N GIDA NAD_binding_9 ApbA NAD_binding_7 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 101213181
NCBI-ProteinID: XP_004138461
UniProt: A0A0A0K7K1
Position
6
AA seq 497 aa AA seqDB search
MKSSQSSRKKVAVVGAGVSGLAAAYKLKSHGFDVTVLEADERVGGKLRSVSYKGLIWDEG
ANTMTESEPEVQCLLDDLGLREKQQFPISQNKRYIVRNGVPVLVPTNPIALIKSNFLSAK
SKFQIILEPFLWKKYDSSKVSDDGTDESVGGFFQRHFGQEVVDYLIDPIVAGTSAGDPDS
LSMSHSFPELWNIEKRFGSIFAGLVLSKLSTKKESGGVRNGTTGKSKPRRGSFSFQNGMQ
TLTDTLSKELGEGVLKLRSEVLSLSYNAGKYASQNWSLIYSKDKNSKDLIADAVIMTAPV
CSVREMKFMKGGIPFSLNFLPEVAYMPLSVMITTFRKESVKRPLEGFGVLVPSSEQQNGL
RTLGTLFSSMMFPNRASNDEYLYTTFIGGSRNRELAKSSTDELKQIVTTDLRQLLGVEGE
PTFINHFYWSKAFPLYGRNYDSVVKAIETMEKNLPGFFYAGNHRDGLSVGKSIASGCKAA
DLVISYLESSTDQSCAE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttcacaatcctccagaaaaaaggtggctgttgttggcgctggtgttagtggg
cttgctgcagcctacaaattgaaatcacatggtttcgatgttacggtgcttgaagcagac
gaaagagttggaggaaagttaagaagcgtctcatacaagggacttatctgggatgaagga
gcgaatacaatgactgagagtgaaccagaggtccagtgcttacttgatgatcttggactt
agagagaaacaacaatttccaatttctcaaaataaacgatatatagtgaggaatggggtg
ccagtactggtgcctacaaatcccattgcattgatcaagagcaactttctctctgcaaaa
tcaaagtttcagatcattttggagccatttttgtggaagaagtatgattcatcaaaagtg
tcagatgatggtactgatgaaagtgtgggtggattctttcagcgccattttggacaagag
gttgttgactatctaattgaccctattgttgctggtacaagtgctggagatcctgactct
ctttctatgagtcattcatttccggagctgtggaatatagagaaaaggtttggttctatt
tttgctggattagtcctctcaaaattgtctaccaaaaaggagagtggtggagtgagaaat
ggtactacaggaaaaagtaaacctcgccgtggttccttttcctttcagaatggaatgcag
acactcactgatacactaagcaaagagcttggtgaaggcgtgcttaagttaagatctgaa
gttttgtcactatcttacaatgctgggaagtacgcatcacaaaattggtcactcatttat
tccaaggacaagaattcaaaggatttaattgctgatgctgttatcatgacggctcctgtt
tgcagtgtcagagaaatgaagtttatgaaaggaggaattccattttcactaaattttctt
cccgaggtggcttacatgccgttatcggtcatgataactaccttcagaaaagagagtgtt
aagcgaccactggaaggatttggagttcttgtaccttcctcagaacaacaaaatggttta
agaacccttggcacactcttttcctccatgatgtttccaaatcgtgcatcaaatgatgag
tatctgtatactacttttattggagggagtcgaaacagggagcttgcaaagtcatcaaca
gacgaattgaagcaaattgttacaacagatctgagacagctgttgggagttgaaggagag
cccacttttatcaaccatttctattggagcaaagcatttcccttatatgggcgtaactat
gattcagttgtgaaggcaattgaaacaatggaaaaaaatcttcctggcttcttttatgca
ggtaaccacagggatggtttgtctgttggcaaatctatagcctccggatgcaaagctgcg
gatcttgtaatttcttatctggaatcttctactgaccaatcatgcgctgaataa

DBGET integrated database retrieval system