KEGG   Cucumis sativus (cucumber): 101214114Help
Entry
101214114         CDS       T02486                                 

Gene name
ICL, Isocitrase
Definition
(RefSeq) isocitrate lyase-like
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00630  Glyoxylate and dicarboxylate metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Module
csv_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101214114 (ICL)
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     101214114 (ICL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 101214114
NCBI-ProteinID: XP_004151880
UniProt: A0A0A0LR30
Position
2
AA seq 576 aa AA seqDB search
MAASFSVPSMIMEEEGRFEAEVAEVQAWWNSERFKLTRRPYTAKDVVSLRGSLRQSYASN
DLAKKLWRTLKTHQANGTASRTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREERAKTPYIDYLKPIIADGDTGF
GGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVGVSEHINRLVAARLQFDV
MGVETILVARTDAVAATLIQTNVDKRDHQFILGATNPNLRGKSLAGALAEAMAAGKTGAE
LQALEDQWISMAQLKTFSECVTDAIMNTNATENEKRRKLDEWMNHSSYEKCISNEQGREI
AEKLGLKNLFWDWDLPRTREGFYRFKGSVMAAIVRGWAFAPHADLIWMETSSPDLVECTT
FAKGMKSIHPETMLAYNLSPSFNWDASGMSDKQMEEFIPRIARLGFCWQFITLAGFHADA
LVVDTFARDYARRGMLAYVERIQREERNNGVDTLAHQKWSGANYYDRYLKTVQGGISSTA
AMGKGVTEEQFKESWTREGAVNLGEEGNVVVAKSRM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccttctctgttccttcgatgataatggaagaagaaggaagatttgaagcg
gaagttgcagaggttcaggcatggtggaattcagagaggttcaagctaacacgacggccg
tacacggcaaaagacgtggtgtcactacgtgggagcctgagacaaagctacgcttcaaac
gatttagctaagaagctgtggcgaaccctcaaaacccaccaagctaacggcacagcctcg
aggacattcggagctcttgaccctgttcaagtgacgatgatggctaagcatttggacacc
atttatgtctccggttggcaatgttcttcaactcacacctccactaacgaacctggcccg
gacctcgccgattacccatacgacactgttccgaacaaggtcgagcatcttttcttcgct
caacagtaccatgacaggaaacagagggaagccaggatgagtatgagtcgagaggaacga
gccaaaactccttacatcgactatctcaaaccgattatcgccgacggtgacaccggcttc
ggcggcaccaccgctacagtgaagctctgtaagctatttgtggaacgcggtgccgccggt
gttcatattgaggatcaatcctctgttacgaagaaatgcggtcatatggcgggaaaagtg
ttggtaggggttagcgaacacatcaatcggctcgtagcggctcgattgcagttcgatgtg
atgggggttgagacgattctcgtggctcgaacggatgcggttgcagctactttgattcaa
acgaatgttgataaacgagaccatcaatttattttgggggcgacgaacccaaatttgaga
gggaagagtttagctggggctttagcagaagccatggcggctggaaaaacaggagcggag
cttcaagctctagaagatcaatggatttccatggcccaattgaaaacattttcggaatgt
gtaacggacgcaatcatgaatacaaacgcaacagagaatgaaaagaggaggaaattagac
gaatggatgaaccattccagttacgagaaatgtatatcgaacgaacaaggacgtgaaatc
gcagagaaattaggactgaagaatctcttctgggattgggatttaccaagaactagagaa
gggttttacagattcaaaggttcggtaatggcggcgattgttcgtggttgggctttcgca
ccacatgcagacttaatctggatggaaacttcaagcccagatttggttgaatgcacaaca
ttcgcaaaagggatgaaatccatacatccagaaacaatgttagcttataatctatcccca
tctttcaactgggatgcatcaggaatgagcgataagcaaatggaagagttcatcccgagg
atcgcgaggctgggtttctgctggcagttcataacactggcgggattccacgcggatgcg
ttggtggtggacacatttgcaagagattacgcgagaaggggaatgttggcatacgtggag
agaattcaaagagaagaaagaaacaatggagtggatacattggcacatcagaaatggtct
ggtgctaactactacgatcggtatctgaagacggttcagggggggatttcgtccaccgcg
gccatgggaaaaggggtaacggaagagcagttcaaggagtcatggacgagggaaggagca
gtgaacttgggagaagaagggaatgtggtggtagccaagtccagaatgtaa

DBGET integrated database retrieval system