KEGG   Cucumis sativus (cucumber): 101215599Help
Entry
101215599         CDS       T02486                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv03040  Spliceosome
csv04141  Protein processing in endoplasmic reticulum
csv04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101215599
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101215599
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101215599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csv01009]
    101215599
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csv03041]
    101215599
   03009 Ribosome biogenesis [BR:csv03009]
    101215599
   03110 Chaperones and folding catalysts [BR:csv03110]
    101215599
   04131 Membrane trafficking [BR:csv04131]
    101215599
   03051 Proteasome [BR:csv03051]
    101215599
   03029 Mitochondrial biogenesis [BR:csv03029]
    101215599
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csv04147]
    101215599
Protein phosphatases and associated proteins [BR:csv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101215599
Spliceosome [BR:csv03041]
 Complex B
  Other components
   Prp19 complex
    101215599
 Complex C
   Prp19-CDC5 complex
    101215599
Ribosome biogenesis [BR:csv03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101215599
Chaperones and folding catalysts [BR:csv03110]
 Heat shock proteins
  HSP70 / DNAK
   101215599
Membrane trafficking [BR:csv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101215599
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101215599
Proteasome [BR:csv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101215599
Mitochondrial biogenesis [BR:csv03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101215599
Exosome [BR:csv04147]
 Exosomal proteins
  Proteins found in most exosomes
   101215599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 101215599
NCBI-ProteinID: NP_001295826
UniProt: Q9M4E6
Position
4
AA seq 647 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVTMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGGEKQFAA
EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVSIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQKFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGGGADDSVPSGGSGAGPKIEEVD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagggagaaggtccggctatcggtatcgatctcggtaccacttactcttgt
gtgggtgtttggcaacacgatcgtgttgagatcattgccaatgaccagggtaacaggact
actccttcctatgttgccttcaccgatactgagcgtttgattggtgatgctgctaagaac
caggtcaccatgaacccgattaacaccgtctttgacgcaaagaggttgatcggtagaaga
ttcagcgactcttcagtccaaagtgacatcaagttgtggccattcaaggtcatccctgga
ccaggtgacaagcccatgatcattgtcagctacaagggtggagagaagcagttcgctgct
gaagaaatctcttccatggttcttattaagatgcgtgaaattgccgaagcttacctcggt
tccactgtgaagaacgccgttgtcactgttcctgcttacttcaacgactcccaacgtcaa
gccaccaaggatgctggtgtcattgctggtctcaacgtcatgaggattatcaatgaaccc
accgctgctgccattgcctacggtcttgacaagaaagcaacaagtgtcggtgaaaagaat
gtctcgatcttcgatcttggtggtggtacttttgatgtctctcttctcaccattgaagag
ggtatcttcgaggtgaaggccactgctggagacactcatcttggtggggaagattttgac
aacagacttgtcaaccactttgttcaaaaatttaagaggaagcacaagaaggatatcagt
ggcaaccccagagctcttagaaggctgagaacttcttgtgagagagctaagagaactctc
tcatctactgctcagaccaccattgagatcgattctttgtacgaaggaattgacttttac
tccaccattactcgtgctagatttgaggaattgaacatggatcttttcagaaagtgtatg
gaacccgtcgagaagtgtttgagagatgccaagatggacaagagcactgtccatgatgtt
gttcttgttggtggttctactagaattcccaaggtccaacagttgttgcaagacttcttc
aatggcaaggaactctgcaagagcattaaccccgatgaagccgttgcctacggtgctgct
gtacaagctgccatcttgagcggtgaaggcaatgagaaggtgcaggatcttcttctattg
gatgtcacccctctttctcttggtttggaaaccgccggtggagtcatgactgttcttatc
ccaagaaacaccacaattcccacgaagaaggaacaagtcttctctacatactccgacaac
cagcccggtgtgttgatccaagtatacgaaggtgaaaggacaagaacccgcgacaacaac
ttgcttggaaaattcgaactctccggaatccctccagctcccaggggtgttccacaaatc
acagtgtgctttgatatcgatgccaacggtatcttgaacgtctctgccgaagacaagacc
acaggtcaaaagaacaaaatcaccattactaacgacaagggaagactctccaaggaggag
attgagaagatggtccaagaggcagagaagtacaagtctgaagatgaggagcacaagaaa
aaggttgaagccaagaatgctttggagaactacgcttacaacatgaggaacactgtgaac
gacgagaagattggtgctaagctttcacccgccgacaagaagaagatcgacgatgccatc
gagcagtccatccaatggctggacgccaaccagctagctgaggctgacgagttcgaagac
aagatgaaggagttggagagcatttgcaacccaatcattgccaagatgtaccaaggtgcc
ggagctgatatgggtggcggtgcagacgacagtgttccttccggcggtagcggtgctgga
cccaagattgaggaagtcgactaa

DBGET integrated database retrieval system