KEGG   Cucumis sativus (cucumber): 101216554Help
Entry
101216554         CDS       T02486                                 

Definition
(RefSeq) transcription elongation factor S-II
  KO
K03145  transcription elongation factor S-II
Organism
csv  Cucumis sativus (cucumber)
Brite
KEGG Orthology (KO) [BR:csv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:csv03021]
    101216554
Transcription machinery [BR:csv03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     101216554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26
Motif
Other DBs
NCBI-GeneID: 101216554
NCBI-ProteinID: XP_004138392
UniProt: A0A0A0KDH9
Position
6
AA seq 369 aa AA seqDB search
MENELVELFEAAKKAADAAAAPSNDGGAEESRCLDALRQLKKFPVTYQILVSTQVGKRLR
HLTKHPKKKIQEHASDLIEMWKEIVIKETNKNKKNGNASSKDSPKIGSPSAESVKVEKFQ
KSSSMKVERVSKVEQFDRNGATSSVKYSKSESVVSERNSVKVEKTDSMVKVERVVKEEKK
PSSGAAAPPKLTSMIKSKDAARDKIRELLFEAFSKVPGEADEEFMDEVNASDPIRVAVSV
ESVMFENWGGSTGAQKAKYRSIMFNLKDPKNPDFRRKVLLGLIKPERMINMSTADMASDQ
RKRENEEIAQKALFDCERGGAPKATTDQFKCGRCGQRKTTYYQLQTRSADEPMTTFVTCV
NCNNHWKFC
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgagctggtggaattgtttgaagcggcgaagaaggctgcagatgccgctgca
gcaccatcaaatgatgggggagccgaagaaagtcgttgccttgatgccctaaggcagctc
aagaaattccctgttacttatcaaatccttgtttccactcaggttgggaagcgtcttcgg
cacctcactaaacaccccaagaagaaaatacaggagcatgcttctgacctgattgagatg
tggaaggagatagtaatcaaggagactaataagaacaagaaaaatggaaatgccagcagt
aaagattcacctaaaattggttctcccagtgcagaatcagttaaggtggagaagtttcaa
aaatcatcttccatgaaggttgagagagtttccaaggttgagcaatttgataggaatggt
gccacaagctctgtaaaatattccaaatcagaaagcgtggtctcggagagaaactctgtg
aaggttgagaaaactgattcaatggtcaaggttgaaagggtagttaaagaagagaagaaa
ccatccagtggcgcagctgcacctccaaaacttacttccatgattaaatcaaaagatgct
gctcgagacaaaattagagaacttctctttgaggctttctccaaagtccctggtgaagct
gatgaagaatttatggatgaggttaatgcaagtgatcctatccgtgttgctgtttctgta
gaatccgtgatgttcgaaaattggggaggttctactggtgcacagaaggccaagtataga
tctataatgtttaacctcaaggatccaaagaacccagactttcgaagaaaagttcttcta
ggacttataaagccagaaaggatgatcaatatgagcacagccgatatggcaagcgatcag
agaaaacgtgaaaatgaagagattgcacagaaagctttgtttgattgcgagcgtggagga
gcaccaaaagctactaccgatcagttcaagtgtggtcgatgtggtcagcgcaaaacaacc
tactatcaattacagacgcggagtgcggatgaacctatgacgacgtttgtaacttgtgta
aactgcaataaccattggaagttctgctga

DBGET integrated database retrieval system