KEGG   Cucumis sativus (cucumber): 101217020Help
Entry
101217020         CDS       T02486                                 

Definition
(RefSeq) steroid 5-alpha-reductase DET2
  KO
K09591  steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00905  Brassinosteroid biosynthesis
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Module
csv_M00371  Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    101217020
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101217020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh PEMT ERG4_ERG24 DUF1295 DUF1230
Motif
Other DBs
NCBI-GeneID: 101217020
NCBI-ProteinID: XP_004137737
UniProt: A0A0A0LAB3
Position
3
AA seq 291 aa AA seqDB search
MRHGTNLKTDPPQISQLDSNLQPESSNPSPTMMGWDQALFHNSLLALYLIGPPTVVSLRF
LQAPYGKHIRPGWGPTMSAPLAWFLMESPTLWLTLLLFPSGDHSSHSKALLLISPFLLHY
LNRTCFYPIRLLWSGTRRNAQVGFPVLVAIMAFGFNLLNSYVQTRSVSHYVKYEGDGWFW
WRFFGGGVVFVMGMAVNIWSDGVLVGLKRRGGGYKVPTGGWFELVSCPNYLGEIMEWLGW
AVMCGSWAGLGFFLYTCANLVPRARANHTWYLNKFGEVYPINRKAVIPFLY
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagacatggtacaaatttgaaaacagatccgccacagatttctcaacttgattcaaac
ctacaaccggaatcctcgaatccatcgcctactatgatgggttgggatcaggctctgttc
cacaacagtcttctcgccctgtacctcattggaccaccgaccgtcgtctccctgaggttt
ctccaggcgccgtacgggaaacacatccgacccgggtggggcccgactatgtcggctcca
ttggcctggttcctcatggaaagtcccaccttatggctgaccctcctcctctttccttcc
ggcgatcactcgtcccattccaaggctctccttctcatctcccccttcctcctccactac
ctcaatcgcacctgcttctaccctattcgtcttctctggagtggaactcgacggaacgcc
caagtcggttttccggtgcttgtggccatcatggcattcggattcaacttgcttaactct
tacgtgcagaccagatctgtgtctcactacgtaaagtacgagggagatgggtggttttgg
tggcggtttttcggtggaggagtggtttttgtgatggggatggcggtgaacatatggtcg
gatggtgtactggtcggactgaagaggaggggcggcggttataaggtgccgacgggaggg
tggtttgagttggtgagttgtcctaattatttgggggagattatggagtggctgggctgg
gcggtgatgtgcgggtcatgggctgggctagggtttttcctttatacgtgtgcaaattta
gtgcctagggcacgtgcaaaccacacgtggtacttgaacaagtttggagaggtttatccc
ataaataggaaggctgtaattcccttcttgtattaa

DBGET integrated database retrieval system