KEGG   Cucumis sativus (cucumber): 101217060Help
Entry
101217060         CDS       T02486                                 

Definition
(RefSeq) pyruvate decarboxylase 1-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00010  Glycolysis / Gluconeogenesis
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101217060
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     101217060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh PNTB
Motif
Other DBs
NCBI-GeneID: 101217060
NCBI-ProteinID: XP_004148630
Position
4
AA seq 628 aa AA seqDB search
MPVNLQNGLQAETISSTISIPTMATRSMLKPPTSNGVYKPHSKSQTITTNNGPQMADPSV
VLSTLGHYLARRLVQIGISDIFSVPGDSNLILLDYFVAEKGLNLVGCCSELNAGYAADGY
ARRRGVGACAVTFTVGGLSLINAIAGAYSDDLPVVCIVGGPNSNEYGNNQTILHHTIGLP
DFSQELQCFRTVTCYQAVINNLKDAQWEIDCAISKCLEESKPVYISIACNLAAIPHPSFS
MQQLIPLSTSPKQSNQTSLEMAVEKAAELLNGAVKPVLVGGKKLRVAKAQAAFMELANTC
DYAVAVTPSAKGMFPENHPHFIGTYWGVISTAFCSETVEIADGSIFAGAIFDELETVGFS
LSYKKNKAIIVETDHVVFPNGLRFGPILMKDFLWALTKRVKPNSTSYENYRRIYIPESSP
ATSEPGEGLRVNVLFKHIQKMLTDDMAVISEAGDSWFHGQKLKLPQSCGYEMQMVYASIG
WSLGATLGYAQASSSNGRVVLCIGDGSFQMAPQDLSTMLRLGQRNIIFLINNGGYTIEVE
IHDGPYNIIKNWDYCALVDAMHNHNGNCWTRKVQTEEQLVKAIEIATRDHNDCLCFIEAI
VHRDDTSKELLEFGNKLAEMNSRPPKSL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaacctacaaaatggactccaagctgaaaccatttcctccaccatatcaata
ccaacgatggctactcgctcaatgctcaaacctcccacctccaatggcgtttacaagcct
cactccaaatctcaaaccattactactaacaatggacctcaaatggctgacccttctgtt
gtcctgtccacgttaggccactacctagcccgtcgtcttgttcaaatcggtatctctgat
atcttttcggttccaggagactccaatctcatacttcttgattactttgtggccgaaaaa
gggttgaaccttgtggggtgttgcagcgagctcaatgctgggtatgcggccgatggctac
gccaggcgtcgtggcgttggagcttgtgctgtgacctttactgttggtgggcttagtttg
atcaacgccattgctggtgcttactctgatgatcttcctgttgtttgtattgttggtggc
cccaactccaatgaatatggaaataaccagacgattcttcatcatacaattgggttgccg
gatttcagtcaagaacttcaatgctttcgaactgtcacttgctatcaggcagttatcaat
aacttgaaagatgcacaatgggagatagattgtgcaatttccaagtgtttggaagaaagc
aagccagtttatattagcattgcttgcaatttggcagcaattcctcatccttctttctct
atgcaacaacttattccactttccacctctcccaagcaaagcaaccaaacgagtttagag
atggcagtggaaaaggcagcagaacttctaaacggcgccgtcaagccagtcttagtcggc
gggaagaagctgcgggtcgccaaagcacaagccgcgttcatggagctagccaacacttgt
gactatgcggtggccgtcacgccgtcagccaaaggaatgttcccggagaaccacccacat
tttatcggaacttactggggagttatcagcactgccttctgcagcgagacggtagaaata
gctgatgggtcaattttcgccggagccatatttgacgaattggaaaccgtcggcttctct
ctttcctacaagaaaaacaaagccattattgtagaaacggatcacgtggtgtttccaaat
gggcttaggtttgggccgattttaatgaaggactttctttgggccctgactaaacgggtg
aagcccaattcaacatcgtatgaaaattatcgtcggatttatattccggagtcaagtcct
gccacgtcagagccgggtgaaggcttacgagtcaacgttcttttcaaacatattcagaaa
atgttgaccgatgacatggcagtaatttctgaggccggtgattcttggtttcatggtcaa
aaacttaaattaccacaatcatgcgggtatgagatgcaaatggtgtatgcatctatcgga
tggtctttaggtgctactcttggatatgcacaagcttcttcatcaaatggtcgtgtggtt
ctttgcattggtgacggaagctttcaaatggctccccaagatttgtccacaatgctaaga
ttaggtcaaaggaacattatattcttgataaataatggtggatataccattgaagttgag
atccatgatggcccatataatatcattaagaattgggactactgtgctctagttgatgcc
atgcataatcacaatggtaactgttggacaaggaaggttcaaacagaggaacaattggtg
aaagcgatcgaaatagcaacaagagatcataatgattgtttgtgcttcatagaggctatc
gttcatagagatgatacaagtaaagagttacttgaatttgggaacaaacttgctgaaatg
aatagtcgtcctccaaaatctttatag

DBGET integrated database retrieval system