KEGG   Cucumis sativus (cucumber): 101219505Help
Entry
101219505         CDS       T02486                                 

Gene name
NCED2
Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00906  Carotenoid biosynthesis
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Module
csv_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    101219505 (NCED2)
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     101219505 (NCED2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 101219505
NCBI-ProteinID: XP_004147768
Position
4
AA seq 594 aa AA seqDB search
MASSSSSSFLQSPFSSSMPDKKLSNYTTNRLLSVSSSLHTPSIIQIPKHSHTTFPSPLQT
SIPKPPPLTTTPPVSGSQDWNFLQRAAAMALDAVENALISAERKHSLPKTADPAVQIAGN
FAPVPEQPVRKGLPVIGKVPDHIRGVYVRNGANPLHEPLSGHHLFDGDGMVHAVEFSEAG
GVSYACRFTETQRLVQERAYGRPVFPKAIGELHGHSGIARLMLFYARGLFGLVDHNHGIG
VANAGLVYFNGRLLAMSEDDLPYQIRVTPAGDLKTVGRFNFDGQLESTMIAHPKLDPVSG
EMFALSYDVIQKPYLKYFKFSPEGEKSPDVEIPLPQPTMMHDFAITEKYVVIPDQQVVFK
LPEMIRGGSPVVYDKEKTSRFGILDKNATDANAIKWIEAPDCFCFHLWNAWEEPETNEVV
VIGSCMTPPDSIFNECEENLKSVLSEIRLNLSTGKSTRRPIITETEQVNLEAGMVNRNLL
GRKTQFSYLALAEPWPKVSGFAKVDVLSGEVKKYLYGEQRYGGEPLFLPREGAEAEDDGH
ILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISCKDLQKQIR
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttcttcttcttcttccttcctccaatctcccttctcttcttcaatgccggac
aaaaaactctctaattataccacaaacagattactttctgtatcctcttctctccatacg
ccttctattattcaaattcctaagcattcccacaccacatttccatctccacttcagact
tcaatccccaaacctcctccccttaccactacaccgcctgtctccggatcacaggactgg
aatttcttgcagcgagctgcggctatggctcttgatgcggttgagaatgctctgatttca
gctgagcgcaagcattcattgcccaagaccgccgaccctgccgttcaaattgctggcaat
tttgctcctgtccccgagcagccggttcggaagggtttaccggtgatcgggaaagttccc
gatcatattcgaggggtttatgtgcgaaacggagccaacccacttcacgaaccgctctct
ggtcatcacttgtttgatggcgatggaatggttcatgctgtcgaattttccgaggccggt
ggcgttagttacgcttgccggtttacggagactcaacggctggttcaggagcgagcttat
ggacgcccggttttcccaaaggcaatcggtgaactccatggacactctgggatagctcgg
ttgatgcttttctatgccagggggttatttggtcttgttgatcacaaccatggaattgga
gtcgccaacgccggtctggtctatttcaacggacggcttcttgccatgtcggaagatgat
ctgccttaccaaatcagagtcactccggcgggtgatttgaaaactgttggccggttcaat
ttcgatggccaactggaatccacaatgattgcccacccaaaactcgaccctgtttccggc
gagatgttcgctttaagctacgacgtaatccaaaagccatatttgaaatactttaaattc
tcaccggaaggagagaaatcaccggacgtcgaaattcccctgcctcagccaacgatgatg
cacgatttcgctattacggagaaatacgtcgtaattcccgatcagcaggtggttttcaag
ttaccggagatgatccgcggcggttctccggtggtatacgacaaagaaaaaacctcccga
ttcggaattttggacaaaaatgcgacagacgccaacgccattaaatggattgaagctcct
gattgcttctgtttccatctctggaacgcttgggaagaacctgaaacgaacgaagtcgtc
gtaattggatcgtgcatgacaccgccggactccattttcaacgaatgcgaagagaatttg
aaatccgttttatcggaaattcgtctgaatctgtccactggaaaatcaacccgtcggcca
ataatcaccgaaacagagcaagtgaacttagaagccggaatggtgaaccgaaatctactt
ggaagaaaaacccaattctcttatcttgctctagcagagccatggccaaaggtttctggt
tttgcaaaggtcgatgttttgagtggagaagtaaaaaagtatctgtatggagaacagagg
tatggtggtgagcctctgtttctgccaagagaaggcgcagaggcggaagacgacggccac
atcttagccttcgttcacgacgagaaggaatggaaatcggagcttcagatagttaacgcc
atgactctggagcttgaagctactgtgaagcttccttctcgagttccttatgggttccat
ggaactttcataagctgcaaggatttgcagaagcagatacggtaa

DBGET integrated database retrieval system