KEGG   Cucumis sativus (cucumber): 101221167Help
Entry
101221167         CDS       T02486                                 

Definition
(RefSeq) legumain
  KO
K01369  legumain [EC:3.4.22.34]
Organism
csv  Cucumis sativus (cucumber)
Brite
KEGG Orthology (KO) [BR:csv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csv01002]
    101221167
Enzymes [BR:csv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     101221167
Peptidases and inhibitors [BR:csv01002]
 Cysteine peptidases
  Family C13: legumain family
   101221167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 101221167
NCBI-ProteinID: XP_004147613
UniProt: A0A0A0KMT9
Position
5
AA seq 490 aa AA seqDB search
MASPSTSNLVLFLLLFLAYGCADASPWDRWERTIRMPTEKEEMGGAGDRKVGTRWAVLIA
GSSGFGNYRHQADICHAYQLLKKGGLKDENIVVFMYDDIATNVLNPRPGIIINHPQGEDV
YAGVPKDYTGEHVTAQNLYAVLLGNRTAVDGGSGKVVDSKPNDRIFVYYSDHGGPGVLGM
PNLPFVYAMDFIEVLKKKHAAKGYKEMVIYVEACESGSIFEGILPKDLNIYVTTASNAQE
SSFGTYCPGMEPAPPPEYMTCLGDLYSVAWMEDSETHNLKRETIDQQYRTVKERTSNPNN
LNTGSHVMEYGNSSIKAERLYLYQGFDPASVNLPPYNGRYEMKSMDAINQRDADIFFLWQ
MYRKFEDGTNERAQVLEEIRETVTHRTHLDGSIRMIGFLLFGPEKGSNILDDVRASGLPL
VDDWECLKSMVRVLESYCGSLTQYGMKHMRAIANICNRGVSKASMREASMVACNGGSYGL
WHPSNRGYSA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccatctacctccaatcttgtcctgtttctccttctgtttcttgcttacggc
tgcgccgacgcctcgccgtgggaccggtgggagaggactatccgaatgccgactgagaag
gaggaaatgggtggtgctggtgatcgaaaagtgggtaccagatgggcagttcttatagct
ggttcttctgggtttgggaattacaggcatcaggcggatatctgccatgcttatcaactg
ttgaagaaaggaggattgaaggatgagaatattgtggtgtttatgtacgatgacatagcc
acaaatgtgctgaatccaaggcctggaatcatcatcaatcatccacaaggagaggatgtt
tatgccggcgttcccaaggattacactggggagcatgtgactgcccagaatctgtatgct
gtgcttctgggaaatagaactgctgttgatggagggagtggaaaagttgtggacagcaaa
ccaaatgacaggatttttgtttactattctgatcatggaggccctggagtacttggcatg
cccaacttgccttttgtctatgccatggatttcattgaagttttaaagaagaaacatgct
gctaaagggtacaaagagatggtgatctatgtagaagcatgtgagagtgggagtatcttc
gagggcatactgccaaaggatctgaatatttatgtaactacagcctcaaatgctcaagag
agtagctttggaacttactgtcctggtatggaaccggcaccaccaccagagtacatgaca
tgcttaggagacttgtatagtgtggcctggatggaagatagtgaaactcacaatctgaag
agagaaacaatagaccaacaataccgaactgtgaaggaaaggacgtcaaatcctaataat
ttgaatacaggatctcatgtaatggaatatggaaactcaagcattaaagcagagaggctg
tacttgtatcaaggatttgacccggcttcagtaaacttgcctccttataatggccggtac
gaaatgaagagtatggacgcaattaaccaaagagatgcagacatcttcttcctatggcaa
atgtacaggaaatttgaagatggaacaaacgagagagcccaagtcctcgaggaaattaga
gagacggtgacacatagaactcacttggatggaagcatcagaatgattgggtttcttctg
tttggaccagagaaaggttccaatattcttgatgatgtgagagcttccggtttgcctctt
gtggatgattgggaatgtcttaaatcaatggtgagagtgttggagagttattgtggttca
ttgacccaatatggtatgaaacacatgcgggcaattgcaaacatatgcaacagaggagtt
tcaaaagcttcaatgagggaagcatcaatggtggcttgcaatggagggagttatgggctg
tggcatccttcaaatcgaggttacagtgcttga

DBGET integrated database retrieval system