KEGG   Cucumis sativus (cucumber): 101221482Help
Entry
101221482         CDS       T02486                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00010  Glycolysis / Gluconeogenesis
csv00562  Inositol phosphate metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101221482
   00562 Inositol phosphate metabolism
    101221482
Enzymes [BR:csv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101221482
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101221482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101221482
NCBI-ProteinID: XP_011655004
UniProt: A0A0A0KM02
Position
5
AA seq 500 aa AA seqDB search
MAARKEIFMAIFLLIFLFLFTHLRAEERSFDVKQHLSTVTRYGAAKGGHYSNYVPAPDGC
IPIHLNLVARHGTRAPTKKRIKELNNLENQLQMLLSAAAGNGLSLHKVPSWLKGWKSPWR
EKVNGGELIPEGEQELYDLGIRTRKLFPDLFSDDYHPDIYTIKATQIPRASASAVAFGMG
LFSGRGNLGLDHHRAFSVVSESRASDTMLRFFDCCQRYEDYRKNQEPEVEKRKEPVLDDI
TKSLTERYGLNFTRQHISSLWFLCKQEASLLDITDQACGMFSQSEVALLEWMDDMEVFIL
KGYGNSLNYRMGVPLLQDIVQSMEKAITAKEEKRVPGSYEKARLRFAHAETVLPFTCLLG
LFLEGGHHGFKQIQREQSLQLPPRPPATRIWKGSAVAPFAGNNMLVLYSCPANNLSDEYL
VQVLHNEEPIAMPGCDGLHFCPFQMFKDKIVAPHLEHDFNTLCTANVEEQTPSPESSKLS
LFHWLFSLWNNDKQPRTDEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaggaaggaaattttcatggccatttttcttctcattttcttattcctattc
actcatttgagggctgaagagcgatcattcgatgtaaagcaacatctgtccacggttacc
agatatggtgcagcaaaaggtggtcattatagtaactatgttcccgctcctgatggatgc
attccaatccatttaaatcttgtggctaggcacggaactcgtgctccaaccaaaaaacgg
atcaaagagttaaacaacttggagaatcaattacagatgcttttaagtgctgctgcaggc
aatggtttatctctgcataaagttccttcctggttgaagggatggaaatctccttggaga
gaaaaagtgaatggtggagaattaattcctgaaggagagcaagaattgtatgatctcgga
attagaacaagaaaattgtttcctgacttgtttagtgatgattatcaccccgacatatat
acaatcaaagcaactcagattcctcgagcatctgctagtgctgtggcatttggtatgggg
ctattcagtgggagaggaaaccttggactagatcatcatcgagctttttctgttgttagt
gagagtcgtgccagtgatacgatgcttaggtttttcgattgttgtcagagatatgaggat
tataggaagaatcaggaacctgaagttgagaagcgtaaagaacctgtacttgatgatatt
actaagtcactcactgaacgttatggtctaaattttacccggcaacacatttcatctctt
tggtttctctgtaagcaggaggcatccttgttggacataacagatcaagcttgtggaatg
ttcagccagtctgaggttgctttgttggagtggatggatgatatggaggtgtttatattg
aagggttatggcaattcattaaactatagaatgggagttcctttgttgcaagatattgtt
caatccatggagaaagctatcacagccaaagaagaaaaacgagttcctggcagctatgag
aaggcaagacttcgttttgctcatgctgaaactgtgcttccattcacatgtttgctcggg
ctcttccttgaaggaggacatcatggatttaaacaaatacaaagggagcagtctttgcaa
cttcctccacggcctccagctactagaatctggaagggaagtgctgttgcaccttttgct
gggaataacatgctggttctctatagctgccccgccaataacttgtcggacgagtacctt
gtgcaagtcttgcataatgaagaacccatagcaatgccgggttgcgatggtttgcatttt
tgccccttccaaatgttcaaggacaaaattgtggcccctcatcttgagcatgatttcaac
acgttgtgcactgcgaatgtggaagaacaaacaccatcgcctgaatcgagtaagttatca
ctgttccattggctcttctcgctgtggaataatgataaacaacctcgaacagatgaattg
taa

DBGET integrated database retrieval system