KEGG   Cucumis sativus (cucumber): 101223112Help
Entry
101223112         CDS       T02486                                 

Definition
(RefSeq) lysosomal beta glucosidase-like
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00460  Cyanoamino acid metabolism
csv00500  Starch and sucrose metabolism
csv00940  Phenylpropanoid biosynthesis
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101223112
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101223112
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    101223112
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     101223112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 101223112
NCBI-ProteinID: XP_004141128
UniProt: A0A0A0LFL8
Position
3
AA seq 628 aa AA seqDB search
MAKNLIFFMGFFIFCLTEVWAKHQYMRYKDPKQPLNVRISDLLGRMTLEEKIGQMVQIDR
TVASKKVMKKYLIGSVLSGGGSVPSKEASPKVWIDMVNEFQKGSLSTRLGIPMIYGIDAV
HGHNNVYKATIFPHNVGLGATRDPNLAKRIGAATALEVRATGISYVFAPCIAVCRDPRWG
RCFESYSEDPKVVQEMTEIISGLQGEIPSNSRKGVPYVAGREKVAACAKHYVGDGGTTKG
MNENNTLASRHGLLSIHMPGYYNSIIKGVSTVMISYSSWNGKKMHENRDLITGFLKNTLR
FRGFVISDWQGIDRITSPPHANYTYSIIAGITAGIDMIMVPFNYTEFIDGLTYLVKTNVI
PISRIDDAVKRILRVKFVMGLFENPLADSSFVNELGKKEHRELAREAVRKSLVLLKNGES
ADKPILPLPKKVPKILVAGSHANNLGFQCGGWTIEWQGLGGNNLTSGTTILSAIKDTVDP
KTKVVFKENPDMEFVKSNKFSYAIVVVGEYPYAETFGDSLNLTIPEPGPSTITNVCGAVK
CVVIVISGRPVVLQPYISSIDALVAAWLPGTEGKGISDVLFGDYGFSGKLSRTWFKTVDQ
LPMNVGDAHYDPLFPFGFGLTTNPIKAN
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaatctcatttttttcatgggatttttcattttttgcttgactgaagtgtgg
gcaaaacatcaatacatgagatataaagacccaaaacaacccttaaatgttcgaataagc
gacctacttggtaggatgactttagaagaaaaaatagggcaaatggtgcaaatcgaccga
accgttgcatcgaagaaggtcatgaagaagtatttaattgggagtgtactaagtggtgga
ggcagtgttccatcaaaagaggcttctcctaaagtatggattgacatggtcaatgaattt
caaaaaggctctttgtcaactcgtcttggcattccaatgatttatggaattgatgcagtt
catggtcacaacaatgtctataaagccacaatttttcctcataatgtggggcttggagct
actcgggatcccaatcttgctaagaggattggagcagctactgcacttgaagttcgagct
actggcatttcttatgtctttgcaccctgtattgcggtttgtagagatccacgttggggt
agatgttttgaaagttatagcgaagaccctaaagttgttcaagagatgactgagattata
tcaggtttacaaggagagattccatcaaactcccgcaagggtgttccctatgttgctgga
agagaaaaagtggcagcttgtgcaaagcattatgtgggtgatggtggaacaaccaaaggt
atgaatgaaaacaacacacttgcaagtagacatggactgcttagcattcatatgccaggt
tactataactcaatcatcaagggtgtatcaactgttatgatctcatactctagttggaac
ggaaagaagatgcacgaaaatcgagatcttattactggctttcttaaaaacactcttcga
tttaggggttttgtcatctcagattggcaaggtattgataggattacctctccacctcat
gctaattatacatattccatcatagcaggcattaccgctggcatcgacatgataatggtt
ccattcaattacacagaatttattgatgggcttacctatttggtaaaaactaatgtaatc
cccattagtcgaattgatgatgctgtgaagagaattttacgagtgaaattcgttatgggt
ttatttgagaacccattagctgattcaagctttgtcaatgaacttggtaaaaaggagcat
agagaattggctagagaagctgtcaggaaatcactagtgttgttaaagaatggagaatct
gctgacaaacctatattacctcttccaaagaaagttccaaaaatacttgttgctggtagc
catgcaaacaaccttggttttcaatgtggtggttggaccatagagtggcaaggtctcggt
ggcaacaatctcaccagtggtacaacaatactttcagcaatcaaggatacagtcgacccc
aaaacgaaagttgtattcaaagagaatccagacatggagttcgtcaagtcgaacaaattt
tcttacgccatcgtagtagtaggagagtatccatatgcagaaacgttcggtgacagctta
aatttaaccattcctgaacctggtccaagcaccatcacaaacgtgtgtggagctgtcaaa
tgtgttgttatagttatctccgggcgacctgtcgtcttacaaccttatatcagttcaata
gatgcactcgttgctgcttggcttccaggaactgaaggcaaagggattagtgacgttttg
tttggtgattatggttttagtggcaagttgtcaaggacatggttcaagacagttgatcaa
ctaccaatgaatgttggagatgcacattatgatcctttatttccatttggatttggtctc
actaccaatcctattaaagccaattag

DBGET integrated database retrieval system