KEGG   Cucumis sativus (cucumber): 101223178Help
Entry
101223178         CDS       T02486                                 

Definition
(RefSeq) dihydroflavonol-4-reductase
  KO
K15891  NAD+-dependent farnesol dehydrogenase [EC:1.1.1.354]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00900  Terpenoid backbone biosynthesis
csv00909  Sesquiterpenoid and triterpenoid biosynthesis
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    101223178
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    101223178
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.354  farnesol dehydrogenase (NAD+)
     101223178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-GeneID: 101223178
NCBI-ProteinID: XP_011654104
Position
4
AA seq 335 aa AA seqDB search
MKILVTGASGYLGGRLCRALLNRGFSVRALVRPTSDLSSLPHDPSALELVHGDITDYQSL
LEACSGCHVVFHAAAMVEPWLPDPSKFISVNVRGLQNVLQAVRETKTIEKIIYTSSFFAL
GSTDGYVAVESQVHHEKFFCTEYEKSKATADKIALQAASEGIPIVPVYPGVIYGVGKVTA
GNVVARMLIERFNGRLPGYLGQGKDKFSFSHVDDVVEGHIVAMQKGRVGERYLLTGENAS
FVEVFDAAAAITGTKKPIFNIPLWLIETYGWVSVFISRITGKLPLISPPTVKVLRHQWAY
SCEKAKQELDYNPRSLKEGLEEMLAWLKSLGLIKY
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcttgttactggggcatctgggtatctaggtggaaggctgtgccgtgcatta
ttgaatcgaggcttctccgttagggctttggtccgtccgaccagcgacctttcttctctt
cctcatgatccttctgctctggagctcgttcatggcgatatcacggattaccagtcgctt
ctagaggcatgctcgggctgccatgtcgtcttccacgcggctgcaatggtcgagccgtgg
cttcctgatccatcgaaattcatttctgtcaatgtacgagggttgcagaacgtattgcaa
gcggttagagagacgaagacaatcgagaagattatttatacgtcatccttttttgcgctt
ggctcaactgatggatatgttgccgttgaaagccaggttcatcacgagaagttcttttgt
acagagtacgagaaatcgaaggccactgctgacaagattgcattgcaagctgcatctgag
gggattccgatagtgccggtttatcccggagttatctatggtgttggaaaagtcacggct
gggaatgttgttgctcgcatgctgattgaacggttcaatgggcgactacccggatattta
ggccaaggaaaggacaagttttcctttagccacgtcgatgatgtggtagaagggcatatt
gtagcaatgcagaaaggtcgagtaggtgagaggtatcttctaacaggagaaaatgcatca
tttgtagaagtttttgatgcagctgcagccattactggtacgaagaaaccaatctttaat
attccattgtggttaattgaaacctatggctgggtttcagttttcatctctcgaatcaca
gggaaacttcctctcatcagccctccgactgtgaaggttttgagacaccagtgggcatat
tcctgtgagaaagcaaaacaagagctggattataacccccgaagcttaaaagaaggatta
gaagaaatgctagcatggctaaagagcttgggtttgataaaatattaa

DBGET integrated database retrieval system