KEGG   Cucumis sativus (cucumber): 105434786Help
Entry
105434786         CDS       T02486                                 

Definition
(RefSeq) transcription factor TCP18-like
Organism
csv  Cucumis sativus (cucumber)
SSDB OrthologParalogGFIT
Motif
Pfam: TCP IMUP Stealth_CR4 FAM199X
Motif
Other DBs
NCBI-GeneID: 105434786
NCBI-ProteinID: XP_011650456
UniProt: A0A0A0LVQ1
Position
1
AA seq 359 aa AA seqDB search
MFFSTNSSGNTKNVHDPFGNLSHDLDHSFHLPISFFPFPSPFEVDDDRDLNFTTNSPSNS
SQNYNNNPPPIISTCNSPPIDNMSMVVMNSDQKMKKMMKKVPQRKRLSKKDRHSKITTAK
GVRDRRMRLSLPVAKQFFGLQDMLGVDKGSKTVEWLLIQAKPEILKLATEKKNHNCFTIS
NSSSNYSNSSELDNEVGVIIGDQNLNTKDNNIKISKKKIKKKKIMRAKQLPIRKTMAKEL
REKARERARARTLEKLKSQMFIRDSACCSDDHQPNFTNINSSSSWSSPFETTGGEESAGT
TTHQSYNNNNNPITSQFDSQFHQIFSSFDVILPKWSPSDDSTFNFLHQQHEFEDSDIFG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctccacaaatagtagtggtaataccaaaaatgtccatgacccatttggtaat
ttgtctcatgatcttgaccattcattccatcttcccatctctttcttcccctttccttct
ccttttgaagttgatgatgatcgtgatctcaatttcactactaattctccctctaattct
tctcaaaattataataataatcctcctcctattatttccacttgtaatagccctcctatt
gacaacatgagcatggtggtgatgaattcagatcaaaagatgaagaagatgatgaagaaa
gtcccacaaagaaaaagattgtcaaaaaaagatagacatagcaaaatcacaacagcaaaa
ggggtaagagatagaagaatgaggctttctttaccggtggctaagcaattctttggatta
caagacatgttgggtgttgataaaggtagcaaaacagttgaatggttgttgattcaagcc
aagcctgaaattttgaaacttgctacagagaaaaaaaaccataattgtttcacgatcagt
aattcttcttctaattattccaattcttcagagcttgataatgaagttggagtaattatt
ggtgatcaaaatttgaataccaaagataataatatcaaaattagtaagaagaagatcaag
aagaagaagattatgagagccaaacaactgccaattagaaaaaccatggccaaagaattg
agagaaaaggcaagagaaagagcaagagcaagaactttggagaagctgaaaagtcagatg
tttattagggattcagcttgttgttcagatgatcatcaaccaaattttaccaacattaat
tcatcttcttcttggagcagtccttttgaaactactggtggagaggaatcagctggtact
actactcatcaaagctacaataataataataatccaatcacttcccagtttgattctcaa
ttccaccaaattttttcttcttttgatgttattttgccaaagtggagcccatctgatgat
tcaactttcaattttctgcatcaacagcatgaatttgaagactctgatatctttggataa

DBGET integrated database retrieval system