KEGG   Cucumis sativus (cucumber): 3429289Help
Entry
3429289           CDS       T02486                                 

Gene name
rbcL, CsCp048
Definition
(RefSeq) RuBisCO large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00630  Glyoxylate and dicarboxylate metabolism
csv00710  Carbon fixation in photosynthetic organisms
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Module
csv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
csv_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
csv_M00532  Photorespiration
csv_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3429289 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3429289 (rbcL)
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3429289 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 3429289
NCBI-ProteinID: YP_247607
UniProt: P27064
Position
CP
AA seq 476 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYGIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKDILN
ATAGTCEEMMKRAIFARELGAPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVI
DRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREITLGFVDLLRDDFVEKDRSRG
IYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANR
VALEACVQARNEGRDLAREGNEIIREASKWSPELVCVTWRKYGKEIKFEFEAMDTL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagattat
aaattgacttattatactcctgaatatgaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaaccgggagttccacctgaggaagcaggggccgctgtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagtcttgatcgttac
aaaggacgatgctatggaatcgagcctgttgctggagaagaaaatcaatatattgcttat
gtagcttatcctctagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtatttggattcaaggctctacgtgctctacgtctggaggatttgcgaatc
cctactgcttatattaaaactttccaaggcccgcctcatggtatccaggttgaaagagat
aaattgaacaagtatggtcgccctctattgggatgtactattaaaccaaaattgggatta
tccgctaagaattatggtagagcagtttatgaatgtctacgcggtggacttgattttacc
aaagatgatgaaaacgtgaattcccaaccatttatgcgttggagagaccgtttcctattt
tgtgcggaagctatttttaaatcacaggctgaaacaggtgaaatcaaagacatactgaat
gctactgcgggtacatgcgaagaaatgatgaaaagggctatatttgcccgagaattggga
gctcctatcgtaatgcatgactacttaacaggtggattcactgcaaatactagcttggct
cattattgccgagataatggtctacttcttcacattcaccgtgcaatgcatgctgttatt
gatagacagaagaatcatggtatgcacttccgtgtactagctaaagcgttacgtatgtct
ggtggagaccatattcacgctggtaccgtagtaggtaaacttgaaggggaaagagaaatc
actttaggctttgttgatttactacgtgatgattttgttgaaaaagaccgaagccgcggt
atttatttcactcaagattgggtctctttaccaggtgttctgccagtggcttccggtggt
attcacgtttggcatatgcctgctctaaccgagatttttggagatgattctgtactacaa
ttcggcggaggaactttggggcacccttggggtaatgcacctggtgccgtagctaaccga
gtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgtgagggt
aatgaaattatccgtgaggctagtaaatggagtcctgaactagtctgcgtgacttggagg
aagtatggtaaggagatcaaatttgaatttgaggcaatggatactttgtaa

DBGET integrated database retrieval system