KEGG   Corynebacterium singulare: CSING_02730Help
Entry
CSING_02730       CDS       T03630                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
csx  Corynebacterium singulare
Pathway
csx00260  Glycine, serine and threonine metabolism
csx01100  Metabolic pathways
csx01110  Biosynthesis of secondary metabolites
csx01120  Microbial metabolism in diverse environments
csx01130  Biosynthesis of antibiotics
csx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSING_02730
Enzymes [BR:csx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CSING_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJI78096
UniProt: A0A0B6F267
Position
complement(547885..548976)
Genome map
AA seq 363 aa AA seqDB search
MIHFGNDYHRSAHPRVLDAIAGAAGAYAGYGADELCTQAAERIRTAYQAPNAEVHFMVGG
TQANATIIAHRLRPWEGVIAADSGHISTHETGAIERTGHKVITLPNQLGKITAAQVRACV
DEYRASGVEEHIPEPALVYITQPTEFGTAYTRAELVALREVCDEYELGLFVDGARLGYGL
SASDITLPDLGALVDVFTIGGTKCGALFGEAIVFPAGAPRFRNAMKQQGGLLAKGWLLGA
QFDALFSAPATTPEAASAHTLSEANSGKETASTLYEHICARANAQAQRIAAAFRAAGIDM
LFDSPTNQQFALLTREQEDTLSQHFVCQFFEEHEGLRVVRLCTAWSTAEGDVDKLCAAIS
ALG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgattcacttcggcaacgactaccaccgctccgctcacccccgcgtccttgatgccatc
gcgggggcggccggggcttatgccggctacggcgccgacgagctgtgcacccaagccgcc
gagcgtatccgcacggcgtatcaggcgccgaacgccgaggtacatttcatggttggtggc
acgcaggccaacgccaccatcatcgcccatcgcctgcgcccctgggagggtgttattgcg
gcggatagcgggcacatctccactcatgaaacgggcgctatcgaacgcaccggacacaag
gtcatcacgctgccgaaccagctgggaaagatcaccgccgcgcaggttcgcgcgtgcgtg
gacgagtaccgtgcctccggggtggaggagcacattccggagccggcgttggtctacatc
acccagcccaccgagttcggcacggcctatacccgcgcggagctggtggccctgcgcgag
gtctgcgacgagtacgaattgggcctgtttgtcgacggcgcccgcctcggctacggactt
tccgcttcagatatcaccctgccggacctaggcgcgcttgtcgacgtcttcaccatcggc
ggcaccaaatgcggcgctctcttcggcgaggccatcgtctttcccgcgggcgcaccgcgt
tttcgcaacgcgatgaagcaacagggcggcctgctggccaaaggctggttgttgggcgcg
cagttcgacgccctctttagcgctcccgctaccacgcctgaggccgcatccgcccacact
ctttctgaggctaactccggcaaggagacagccagcacgctctacgaacacatctgcgcc
cgcgccaacgcccaagcccagcgcattgctgcggcttttcgcgcagctggcatcgacatg
ctcttcgattcccccaccaaccagcaattcgcactgctgacccgcgagcaagaagacacg
ctctcgcagcacttcgtgtgccagttcttcgaagaacacgaagggctacgcgtggtgcgg
ttgtgtacggcgtggtcgactgcggagggggacgtcgataagctctgtgctgcgatttct
gcgctcgggtag

DBGET integrated database retrieval system