KEGG   Corynebacterium singulare: CSING_09660Help
Entry
CSING_09660       CDS       T03630                                 

Gene name
pld
Definition
(GenBank) phosphodiesterase/alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
csx  Corynebacterium singulare
Pathway
csx00790  Folate biosynthesis
csx01100  Metabolic pathways
csx02020  Two-component system
Module
csx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:csx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CSING_09660 (pld)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSING_09660 (pld)
Enzymes [BR:csx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CSING_09660 (pld)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AJI79448
UniProt: A0A0B6EXA3
Position
2023152..2024792
Genome map
AA seq 546 aa AA seqDB search
MRRSFSRRRLLHATGLATATAASLAASSASAADPNASASLGLVEPPEGQLPFVHGVASGD
PIPDSVILWTRVTPTEEALPGSGVGPAVTVEWEVARDEGMGDVVKRGHAHATADHDHTVH
VDPHGLEPDTVYFYRFIVDGASSPIGRTKTAPAANASPDKLTFGVASCANWESGFFSAYR
DIAQRARGGQLDYMVFLGDYIYEYRSGAYSGFGPVRLHHPAHEITTLADYRTRYGRYRTD
PDLQEAHAALPWVVVWDDHEIANDNWAGGAENHSPATEGSWAARQSAAMRAYFEWMPVRA
TAPSEAGHLYRSLTFGDLVELTMMDLRTYRDEQVSWNPVAFAQEGRSMLGSEQYAWLLGK
IETSQATWKVLGNSVMFAPLNLISLQENSMTAQVAAALTDNITSIPINGDQWDGYSAERR
ALIDALPTHTLFLTGDIHTEWAHAITTGSRVVGAEMVCASVSAPNINEALNLRQGNTVSQ
TAQQLLRAANPHCHHVDLDSHGYSFVTITREEAQMHWLRVEDLLKPGSPVHEAVSMTFKP
GVGFVS
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttccttctctcgtcgccgactcctgcacgccaccggcctggccaccgccacg
gccgcttcactcgccgcatcctccgcctccgcagcggatccaaatgcttccgcctccctc
ggcctcgttgagccgccggaaggacagctccccttcgtacacggagtggcctcgggagat
ccgattccggattcggtcattttatggacgcgcgtaacgcccacggaggaggcccttcct
ggcagcggcgtgggcccagcagtcaccgtggaatgggaagtggcccgggatgaggggatg
ggggacgtcgtcaagcgtggccacgcccacgccaccgcggaccatgaccacaccgtccac
gtggacccgcacggcctcgagccggacacggtgtatttttaccgcttcatcgtagacggt
gcctcctcccctattggacgcaccaagactgcacccgccgcgaatgcctccccggacaag
ctcacctttggtgtggcctcgtgcgccaattgggagtccggtttcttcagcgcctaccgg
gacatcgcacagcgagcccgcggtgggcagctggactacatggtctttttgggtgattac
atctacgagtatcgctccggcgcctactccggtttcgggccggttcgcctgcaccaccca
gcgcacgagattacaacgctggcggattaccgcacgcgctacggacgctatcgtaccgac
ccggacttgcaggaagcccatgcagcgctgccatgggtcgtggtgtgggatgaccacgag
attgctaacgataactgggccggtggcgctgagaaccacagccccgccacggaaggcagc
tgggccgcgcgacagtcagcggcaatgcgcgcctacttcgagtggatgccggtgcgcgcc
accgcgccatccgaggctgggcatctctaccgttccctcaccttcggtgacttggtggag
ctgaccatgatggacctgcgcacctaccgcgatgagcaggtgtcttggaaccccgtggct
ttcgcccaagaaggccgctcaatgctgggctcggagcagtacgcgtggctgttgggcaag
attgagacctcgcaggccacgtggaaagtgctgggcaattccgtcatgttcgccccactc
aatctcatttctcttcaggagaactccatgacggcgcaggtggctgcggcactgacggac
aacatcaccagtatccccatcaacggtgaccagtgggatgggtactccgccgaacgccgt
gcgcttatcgacgccctccccacccacaccctttttctcaccggtgacattcacaccgaa
tgggcccacgccatcactacaggcagccgagttgtgggggccgaaatggtgtgcgcatcc
gtctcggcgcccaatatcaacgaggcgctcaacctgcgtcagggaaacaccgtctcacag
accgcacagcagctcctccgcgcagcgaacccgcactgccatcacgtggacttggacagc
cacggctacagctttgtcaccatcacccgcgaggaggcacagatgcactggctgcgagtg
gaggacctgcttaaacccggttctccggttcacgaggcggtctcgatgacattcaaacca
ggcgttggtttcgtgtcatag

DBGET integrated database retrieval system