KEGG   Corynebacterium singulare: CSING_11210Help
Entry
CSING_11210       CDS       T03630                                 

Gene name
fadA2
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csx  Corynebacterium singulare
Pathway
csx00071  Fatty acid degradation
csx00280  Valine, leucine and isoleucine degradation
csx00310  Lysine degradation
csx00362  Benzoate degradation
csx00380  Tryptophan metabolism
csx00620  Pyruvate metabolism
csx00630  Glyoxylate and dicarboxylate metabolism
csx00640  Propanoate metabolism
csx00650  Butanoate metabolism
csx00900  Terpenoid backbone biosynthesis
csx01100  Metabolic pathways
csx01110  Biosynthesis of secondary metabolites
csx01120  Microbial metabolism in diverse environments
csx01130  Biosynthesis of antibiotics
csx01200  Carbon metabolism
csx01212  Fatty acid metabolism
csx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSING_11210 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    CSING_11210 (fadA2)
   00640 Propanoate metabolism
    CSING_11210 (fadA2)
   00650 Butanoate metabolism
    CSING_11210 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSING_11210 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    CSING_11210 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSING_11210 (fadA2)
   00310 Lysine degradation
    CSING_11210 (fadA2)
   00380 Tryptophan metabolism
    CSING_11210 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CSING_11210 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSING_11210 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSING_11210 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csx04147]
    CSING_11210 (fadA2)
Enzymes [BR:csx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CSING_11210 (fadA2)
Exosome [BR:csx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CSING_11210 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt LysR_substrate
Motif
Other DBs
NCBI-ProteinID: AJI79738
UniProt: A0A0B6EY58
Position
2349844..2351142
Genome map
AA seq 432 aa AA seqDB search
MTTPQHRVAILGGNRIPFARSNKQYAHASNQDMLTSALDGLVARYGLHDERLGLVAAGAV
LKHSRDFNLTREVVLGSALDSTTPAIDVQQACCTSLAAAIHVGDAIAQGRISAGIAGGTD
TTSDAPLAVNDNLRRTLLNLTRAKSAAQRAQLIGSIRPSQLAPEQPQNGEPRTGLSMGDH
AAITAREMKVSREAQDELALASHQNLHKAWEEGFFTDLTTGFLGVNRDTNLRPDSSLESL
AKLKPVFGKRDAEQHGAQATMTAGNSTPLTDGASVALLSSEEWAAEHNIEPRAFLVDSET
AAVDFVHGPDGLLMAPTYAVPRLLERNNLSLQDFDFYEIHEAFASQVLATLSAWEDETYC
RERLGLQSALGSIDRSKLNVKGSSLAAGHPFAATGTRILATTAKILEENGGGRALISICA
AGGQGVAAIVER
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccctcagcaccgcgtagccattctgggcggcaaccgcatcccgtttgcccgc
tcgaataagcagtacgcccacgcttccaaccaggacatgctcaccagcgctctcgatggc
ctcgtggctcgttacggcctccacgacgagcgcctgggactcgtggccgccggtgctgtg
ctcaagcactcccgcgacttcaacctcacccgtgaggtcgtcctcggctccgcgctggac
tccaccaccccggctatcgacgtgcagcaggcctgctgcacctccctcgccgctgccatc
cacgtcggcgacgctattgcccagggccgcatttccgctggtatcgccggcggcacggac
accacgtcggatgccccgctcgccgtcaatgacaacctgcgccgcactctgctcaacctc
acccgcgccaagtccgccgcccagcgcgcccagctcatcggctccatccgcccctcccag
ctggccccggagcagcctcagaatggtgagccgcgcaccggcttgtccatgggtgaccat
gccgccatcaccgcccgcgaaatgaaggtcagccgtgaggctcaggatgaacttgcactg
gcctcccaccagaacctccacaaggcctgggaagagggcttctttaccgacctaaccact
ggcttcctcggcgtgaaccgcgataccaacctgcgcccggattcttcccttgagtctctg
gccaagctcaagccagtcttcggcaagcgcgacgccgagcagcacggagcccaggccacc
atgacggcaggtaactccacgccgttgaccgatggtgcctccgtcgccctcctcagctct
gaggaatgggccgctgagcacaacattgagccgcgcgccttcctcgttgactctgaaacc
gccgccgtcgacttcgtccacggcccggatggcctgctcatggcccccacctacgctgtt
ccgcgcctcttggagcgcaacaacctctccctgcaggacttcgacttctacgaaatccac
gaagccttcgcctcccaggtcctggccaccctctccgcatgggaagacgagacctactgc
cgcgagcgcctcggtctgcagtccgcactcggctcgatcgaccgttccaagctcaacgtc
aaggggtcctcgctcgctgccggccacccgttcgcggcaaccggaacccgcattcttgct
acgactgcgaagattctcgaagagaacggcggcggccgcgccctgatctccatctgtgct
gccggcggccagggtgttgcagccatcgtcgagcgttaa

DBGET integrated database retrieval system