KEGG   Cenarchaeum symbiosum: CENSYa_0972Help
Entry
CENSYa_0972       CDS       T01380                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
csy  Cenarchaeum symbiosum
Pathway
csy00010  Glycolysis / Gluconeogenesis
csy01100  Metabolic pathways
csy01110  Biosynthesis of secondary metabolites
csy01120  Microbial metabolism in diverse environments
csy01130  Biosynthesis of antibiotics
csy01200  Carbon metabolism
csy01230  Biosynthesis of amino acids
Module
csy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CENSYa_0972
Enzymes [BR:csy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     CENSYa_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_N Gp_dh_N Gp_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABK77604
UniProt: A0RW87
Position
complement(1030389..1031432)
Genome map
AA seq 347 aa AA seqDB search
MKRVFVNGYGSIGRRLASFLSEDDEIDLTGVAKYSPGAGVSEARSKGLNVYVPHEKKSEF
AEYETAGSIEDAVRSCDLVIDASPGGRGYDNKKSLYEPLGRMAIYQGGETIYGERAVSDV
LFNSRANYDSAIGKSHILQGSCNVTGMGRILKPLYEKFGSRMGRIDVTLVRRWADIEQKD
KEITDTIEMTPHPHHGEDVRSYMGDIPLFLRAIKVPTRQMHLHIMDVRFTGGAPQADEVL
DALSGEQGVAILWTARGTREVRQCADSMGFGFADTNMVHVHANMASAAGDTIQLMYSDDQ
TGIVIPENHMLLQAMLFGRPYAEAAARTESLFRMGEKKKILEDTFAR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcgtctttgtcaacgggtacggctcgataggcaggcggctggcgtcctttctc
tccgaagacgacgagattgatctcaccggggttgcaaagtactcgcccggcgctggggtc
tccgaggcccgctcaaagggcctcaacgtgtatgttccacacgagaaaaagtccgagttt
gcagaatacgagacggcgggctctatcgaggatgctgtgcgcagctgcgaccttgtaata
gacgcctcgcccgggggcagaggatacgacaacaagaaatccctgtacgagccgcttggc
aggatggcgatataccagggcggcgagacgatatacggggagcgcgcagtatccgatgtt
ctcttcaactcgcgcgccaactatgattcagccattggaaagagccacatcctgcagggc
agctgcaatgtaactggcatgggcaggatactcaagccgctctacgaaaagttcggctcc
cgcatggggaggatagacgtcaccctggtccgcaggtgggccgacatagagcaaaaggac
aaggagataacagatacaatcgagatgacgccccacccgcaccacggcgaggatgtacgg
tcgtacatgggggacataccgctgtttttgcgcgcgataaaggtgccaaccaggcagatg
cacctgcacataatggacgtgcgatttacaggcggggccccgcaggcagatgaagtgcta
gacgcgctatccggcgagcagggcgtggccattttatggacagcccggggcacgcgcgag
gtccgccagtgcgccgattcaatggggtttggctttgcggataccaacatggttcacgtg
cacgccaacatggcgtctgcggcaggcgatacaatccagctgatgtattcggacgaccag
acgggcatagtcatacctgaaaaccacatgctgctccaggccatgctgtttgggcggcca
tacgcagaggctgcagcccgcacagaatcgctgttccgcatgggcgaaaagaaaaagatc
ctcgaggatacgttcgcgcgctga

DBGET integrated database retrieval system