KEGG   Cenarchaeum symbiosum: CENSYa_1068Help
Entry
CENSYa_1068       CDS       T01380                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
csy  Cenarchaeum symbiosum
Pathway
csy00250  Alanine, aspartate and glutamate metabolism
csy01100  Metabolic pathways
csy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CENSYa_1068
Enzymes [BR:csy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CENSYa_1068
Peptidases [BR:csy01002]
 Cysteine Peptidases
  Family C44
   CENSYa_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase QueC tRNA_Me_trans NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ABK77698
UniProt: A0RWI1
Position
1112509..1113294
Genome map
AA seq 261 aa AA seqDB search
MDLLAAIEDAIRQSVPAGRIGVAFSGGVDSALVGAVCKNMGYEVELLTVGFAGSQDLSFA
AEAAPEDTPHHTLEIDQSGFDKVARSVEDTMGASPEDTLSWYENGIAFHYVAVLAHENDL
HTVLTANGIDELFCGYDVYRREYGQGSPEDMIRGKVEHELKMMEAVGRVTAAQGVQLLQP
LLSPKFVEAAGTIPIEQKIRGPDDMLRKHAIRDAARRIGVPEISAGRRKKALQYGSGIHK
ALIKSRRSRGLHARQSGAPRI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcttgccgccatcgaggatgcaatacgccagtcagtcccggcaggaagaata
ggggtggccttctcagggggagtcgacagtgctctagtgggagcagtatgcaagaacatg
ggatacgaggtagagctgctgacggtcggatttgcgggatcgcaggatctatcctttgca
gcagaggcggcaccagaagatacaccgcaccacaccctggagatagaccagagcggcttt
gacaaggtggcccggtcggtagaagatacaatgggtgcttccccggaggatactctatca
tggtatgagaacggcatagcgttccactatgttgcagtgctggcacatgagaacgatctg
catacagtactcacggcaaacgggatagacgagctgttctgcgggtatgacgtgtacaga
agagagtacggccaaggcagtccagaggatatgatccgcggcaaagtagaacatgaatta
aagatgatggaggcagtaggccgtgtaaccgcggcacagggcgtacaactgttacagccg
ctgctctcgccaaaatttgtagaggccgccgggaccatccctatcgaacagaagatccgc
ggccccgatgacatgctccgcaagcacgcaataagggatgctgcgcgcagaataggcgtc
cccgagatatccgcaggcaggagaaaaaaggcgctacagtacggctcgggcatccacaag
gcgctgataaagtctaggcggtcccgcgggctgcacgctcgacaatccggcgcaccccgg
atatga

DBGET integrated database retrieval system