KEGG   Cenarchaeum symbiosum: CENSYa_1277Help
Entry
CENSYa_1277       CDS       T01380                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
csy  Cenarchaeum symbiosum
Pathway
csy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csy01100  Metabolic pathways
csy01110  Biosynthesis of secondary metabolites
csy01130  Biosynthesis of antibiotics
csy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CENSYa_1277
Enzymes [BR:csy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CENSYa_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABK77900
UniProt: A0RX33
Position
complement(1295547..1296299)
Genome map
AA seq 250 aa AA seqDB search
MLETLVKNSRTSVDAGVYEIRGAARGGRSIKWKEGRAALITEVKLASPSAGWIREGADPE
EIAASMVRGGADALSVLTQPLLFHGSPEYFARVRRSVDVPMIMKDIIVDEAQVAAAEALG
ADYMLLIQSVFDGGYAHNMDEFIEMGHNRGVRTLLEVHTAAEFERAQNTEADLIGINNRN
LDTLEIDLGTTEEILAGRNTRSRVISESGIKSAADIARLKKAGAAGFLVGSGIMGGRDIE
GTVREMISAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagacgctggtaaaaaattccagaacttcggtggatgcgggggtatacgagata
cggggtgcggcgcgcggcggccgctccataaagtggaaggaggggcgcgcggcgctcata
acggaggtaaaacttgcctcgccgtctgcgggctggataagggagggcgcagaccccgag
gagatagccgcctctatggttaggggcggcgccgacgcactctcggtgctcacgcagcct
ctgctgtttcacggctcgccggagtactttgcacgggtccgccgctcggtggatgtgccc
atgatcatgaaggatatcatcgtggatgaggcgcaggtggcggccgcagaggcccttggc
gccgattatatgctgctcatacagtcggtctttgacggggggtacgcgcataacatggac
gagttcatagagatggggcacaacaggggggtaaggacgctcctcgaggtgcacacggcg
gcagagtttgagcgcgcgcaaaatacagaggccgacctgatagggataaacaaccggaat
ctcgacacgctcgagattgaccttggtaccaccgaggagatactcgccggcaggaataca
agatcccgggtcatatcggagagcgggataaaatcggcggccgacatagctagattgaaa
aaggccggcgccgccggctttcttgtgggctctggcataatgggcgggcgcgacatagag
ggaacagtcagggagatgatctctgcatgctag

DBGET integrated database retrieval system