KEGG   Cenarchaeum symbiosum: CENSYa_1432Help
Entry
CENSYa_1432       CDS       T01380                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit A
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
csy  Cenarchaeum symbiosum
Pathway
csy00680  Methane metabolism
csy01100  Metabolic pathways
csy01120  Microbial metabolism in diverse environments
csy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csy00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CENSYa_1432
Enzymes [BR:csy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     CENSYa_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: ABK78054
UniProt: A0RXI7
Position
1449921..1450346
Genome map
AA seq 141 aa AA seqDB search
MRGTVHLGNPESTVAVCTLSSMDLLDRIAGSELMEEIALAGRLLSENEGIDALIRSANSG
NIRTVVLCGREVRGHLAGHSLLELHKNGIGPGGRIAGSASPHPVLESGQAEVDLFRGRVD
IIDAIGETGLDDIGRLVRSAQ
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgggacagtccaccttggcaacccggaatcgactgtcgcagtctgcactctttca
agcatggacctgctcgacaggatagcaggctcggagctgatggaagagatagccctggcg
ggcaggctgctctcggagaacgagggaatagacgcgctaatccgctcggcaaactctggg
aacatcaggactgtcgtgctctgcggcagggaggtgcgggggcacctggcgggacactcg
cttctggaactgcacaaaaacggcatcggtcccggtggcaggatagccggttctgccagc
ccccatcccgtgctggagtcgggccaggccgaggtggatctcttccggggcagggtggat
atcatagacgcgataggcgagaccggccttgatgatataggcaggctggtccgctccgct
cagtag

DBGET integrated database retrieval system