KEGG   Cronobacter sakazakii Sp291: CSSP291_00230Help
Entry
CSSP291_00230     CDS       T02461                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00630  Glyoxylate and dicarboxylate metabolism
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01120  Microbial metabolism in diverse environments
csz01200  Carbon metabolism
Module
csz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CSSP291_00230
Enzymes [BR:csz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CSSP291_00230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: AGE84648
Position
33173..34480
Genome map
AA seq 435 aa AA seqDB search
MTTTRTQQIQQLEQEWTNPRWEGIRRPYSAQDVVKLRGSVNPECTLAQLGAARMWRLLHG
ESKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLAASMYPDQSLYPANSVPA
VVERINNTFRRADQIQWAAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLLIARTDADAAD
LITSDCDPYDSEFITGERTSEGFFRTRAGVEQAISRGLAYAPYADLVWCETSTPDLDQAR
RFAEAIHARFPGKLLAYNCSPSFNWKKKLDDKTIASFQEELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDNVTTIIQGGV
SSVTALTGSTEEAQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacacgtacccaacagattcagcagttagagcaggaatggacaaacccgcgc
tgggagggcattcgccgcccttatagcgcgcaggatgtggtgaaattgcgcggttcggtc
aatccggaatgcacgctggcgcagcttggcgcggcgagaatgtggcgtctgctgcatggc
gagtcgaaaaagggctacgtcaacagcctgggcgcgctgaccggcgggcaggcattgcag
caggcgaaagcggggatcgaggccatctatctctccggctggcaggtcgcggcggacgcc
aaccttgccgccagcatgtatccggaccagtcgctctatccggcgaactccgtgcctgcg
gtggttgagcggatcaacaacacgtttcgtcgcgccgatcagatccagtgggctgcgggc
attgagcctggcgatccgcgttatgtcgactattttctgccgatcgtggctgatgccgaa
gcaggttttggcggcgtgctcaatgcgttcgagctgatgaaagcgatgattgaagccggt
gccgcggcggtgcactttgaagatcagctcgcctcggtgaaaaagtgcggtcatatgggc
ggcaaagtgctggtgcccacgcaggaagctatccagaagctcgttgcggcccggctcgcg
gccgacgttatgggcgttccgacgttgctgattgcgcgcaccgacgccgatgcggcggat
ctcatcacctccgactgcgatccgtatgacagcgaattcattaccggcgagcgtaccagc
gaaggtttcttccgcacccgcgcgggcgtcgagcaggcaatcagccgcgggctcgcctat
gcgccgtatgcggatctggtgtggtgtgaaacctccacgccggatctcgaccaggcgcga
cgcttcgccgaagccatccacgcccgcttccccggcaagctgctggcgtataactgctcg
ccgtcgttcaactggaagaaaaagctcgatgacaaaaccatcgcgtctttccaggaggag
ctgtcggcgatggggtacaaataccagttcatcacgctcgcgggcattcacagcatgtgg
ttcaacatgtttgacctcgcccacgcctacgcgcagggcgaagggatgcggcattacgtc
gagaaagtgcagcagccggaatttgccgcgggtaaagagggctacacctttgtgtcgcac
cagcaggaggtgggcaccggttactttgataatgtcacgactattatccagggcggcgtg
tcatccgtaacggcgttaaccggctcgaccgaagaagcgcagttctga

DBGET integrated database retrieval system