KEGG   Cronobacter sakazakii Sp291: CSSP291_02345Help
Entry
CSSP291_02345     CDS       T02461                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00071  Fatty acid degradation
csz00280  Valine, leucine and isoleucine degradation
csz00310  Lysine degradation
csz00362  Benzoate degradation
csz00380  Tryptophan metabolism
csz00620  Pyruvate metabolism
csz00630  Glyoxylate and dicarboxylate metabolism
csz00640  Propanoate metabolism
csz00650  Butanoate metabolism
csz00900  Terpenoid backbone biosynthesis
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01120  Microbial metabolism in diverse environments
csz01130  Biosynthesis of antibiotics
csz01200  Carbon metabolism
csz01212  Fatty acid metabolism
csz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSSP291_02345
   00630 Glyoxylate and dicarboxylate metabolism
    CSSP291_02345
   00640 Propanoate metabolism
    CSSP291_02345
   00650 Butanoate metabolism
    CSSP291_02345
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSSP291_02345
   00072 Synthesis and degradation of ketone bodies
    CSSP291_02345
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSSP291_02345
   00310 Lysine degradation
    CSSP291_02345
   00380 Tryptophan metabolism
    CSSP291_02345
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CSSP291_02345
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSSP291_02345
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSSP291_02345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csz04147]
    CSSP291_02345
Enzymes [BR:csz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CSSP291_02345
Exosome [BR:csz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CSSP291_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C DUF840
Motif
Other DBs
NCBI-ProteinID: AGE85067
Position
458668..459846
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGQLARRSAVELGAVVIEALLTRTGLNPQDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRTGEPGDSHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYALA
SQHKARVAIDSGRFRDEIVPVVIEQMQGAPLVVDTDEQPRADTSAEGLARLSPAFDRLGS
VTAGNASSMNDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRQARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtaattgtcggggccgctcgcacgcccattggctgctttcagggccag
cttgcgcgtcgctcggcggtcgagctcggcgcggtggtcattgaggcactgctgacgcgc
accgggcttaaccctcaggatgtcgatgaagttatcctgggccaggtgctgacggcaggc
gcaggccagaatccggcgcggcagactgcgctcaacagcggtctgccgtggtcggtttcg
gcgattaccatcaatgatgtgtgcggctctggcctgaaggcgctgcatctggcgacgcag
gcgatccagtgcggtgaggcggatgtggtgattgctggcggtcaggaaaatatgagtcgc
gcgccgcatgtgctgaccgaagggcgcaccggcgagcccggcgacagccatattatcgac
agcctggtgcatgacgggctgtgggatgcgtttaacgattaccatatgggcgtcacggcg
gaaaatctggcgcgcgaatataacatcagccgcgaacatcaggatgcatacgcgcttgca
tcacagcataaggcgcgggtcgctatcgacagcgggcgctttcgtgacgaaatcgtgccc
gtcgtgatcgaacagatgcagggcgcgccgctggtggtcgataccgacgagcagccacgc
gccgataccagcgcggaagggctggcgcgcctgtcgcccgcctttgaccggctgggaagc
gttactgcgggcaacgcctcgtcaatgaatgatggcgcggcggcggtgctgatgatgagc
gccagcaaggcgcaggaaatggggctgccggtgctcgcgcgcatacgcgctttcgcaagc
gtgggcgtcgatccggcgctgatgggtatcgcgccggtctacgctacgcggcgctgcctg
gagcgcgcgggctggcagctcaatgatgttgatcttatcgaggccaatgaggcattcgcg
gcacagacgttgtcagtcggtaagctactggagtgggacgagcgcaaggtgaacgttaac
ggcggtgcgattgccctgggacatccgattggcgcgtccggctgccgcattctggtttct
ctggtccatgagatggtgaaacgtcaggctcgcaaagggctcgccacgctttgcattggt
ggcggccagggcgtggcgttggcgattgaacgcgattaa

DBGET integrated database retrieval system