KEGG   Cronobacter sakazakii Sp291: CSSP291_03640Help
Entry
CSSP291_03640     CDS       T02461                                 

Gene name
ndk
Definition
(GenBank) mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00230  Purine metabolism
csz00240  Pyrimidine metabolism
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01130  Biosynthesis of antibiotics
Module
csz_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
csz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
csz_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
csz_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CSSP291_03640 (ndk)
   00240 Pyrimidine metabolism
    CSSP291_03640 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csz04131]
    CSSP291_03640 (ndk)
Enzymes [BR:csz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CSSP291_03640 (ndk)
Membrane trafficking [BR:csz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CSSP291_03640 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGE85326
Position
765273..765704
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGSIFARFESAGFKIIGTKMLHLTVEQARGFYAEHEGKPFF
DGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLRADYADSFTENGTHGSD
SVESANREIAYFFGEGEICPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgagcgtactttttccatcatcaaaccgaacgcagtcgctaaaaacgttatc
ggcagcattttcgcgcgttttgaatccgcaggcttcaaaatcatcggtaccaaaatgctg
cacctgaccgttgagcaggcgcgcggtttttatgccgagcacgaaggcaagccgttcttt
gacggtctggtggaattcatgacctctggcccgatcgtagtttccgtactggaaagcgaa
aacgcggtacagcgtcaccgtgacctgctgggcgcgaccaacccggcaaacgcgctggca
ggtactctgcgcgctgattacgcagacagcttcaccgaaaacggcacccacggttccgat
tccgttgagtctgctaaccgcgaaatcgcctacttcttcggcgaaggcgaaatctgcccg
cgcactcgctaa

DBGET integrated database retrieval system