KEGG   Cronobacter sakazakii Sp291: CSSP291_06980Help
Entry
CSSP291_06980     CDS       T02461                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
csz  Cronobacter sakazakii Sp291
Brite
KEGG Orthology (KO) [BR:csz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:csz03009]
    CSSP291_06980
Enzymes [BR:csz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CSSP291_06980
Ribosome biogenesis [BR:csz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CSSP291_06980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_23 Methyltransf_12 Methyltransf_32 Methyltransf_29 MTS CMAS PCMT MetW AviRa
Motif
Other DBs
NCBI-ProteinID: AGE85993
Position
1452791..1453606
Genome map
AA seq 271 aa AA seqDB search
MSFICPLCHLPLEPQANSFRCASHHQFDIAKEGYVNLLPVQHKRSRDPGDSTEMMQARRA
FLDAGHYAPLRERTAQLLNKRLPQSGATLLDIGCGEGYYTSAFATLTTIHGGQSFGLDVS
KSAIRFAAKRYTDISFCVASSHRLPFADAFFDAVVRIYAPCKAEELARVVKPGGVVVTVT
PGPRHLIQLKGLIYDEVRLHAPNEESLPGFTLAEEQALRYEMCLNGEEATTLLQMTPFAW
RARPEVWAALKEQTAFDCETDFCLRVWQREA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttatttgccccctttgccatttgccgctggagccgcaggccaacagctttcgc
tgtgccagtcatcatcagtttgatatcgcaaaggaagggtacgtgaatcttcttccggtg
cagcataagcgctcgcgggatccgggcgacagtaccgaaatgatgcaggcgcgccgcgcg
tttctcgatgccggtcactacgcgccgcttcgcgagcgaaccgcacaattgttgaataag
cgcctgccgcaaagcggtgccacgctgctggatattggctgcggagaagggtattacacc
agcgcgtttgccacgctcacgaccatccacggcgggcagagctttgggcttgatgtatca
aaaagcgccatccgttttgccgcgaagcgttatacggatatctcgttttgcgtcgcctcc
agccaccggttgccgttcgcggatgcctttttcgatgcggtggtgcgcatttacgcgccc
tgcaaggccgaagagctggcgcgtgtggtgaaacccggtggcgtggtggtgaccgtcacg
cctggcccgcgtcatcttatccagctcaaagggcttatttatgatgaagtgcggctgcat
gcgccgaatgaagaatcgctgcccggctttacgctcgccgaagaacaggcgttacgctat
gagatgtgcctgaatggcgaagaggcgacgacgcttttacagatgacgcctttcgcctgg
cgcgcccgcccggaagtatgggcggcgctaaaagaacaaacggcgtttgactgtgaaacc
gatttttgcctgcgcgtctggcagcgcgaggcttaa

DBGET integrated database retrieval system