KEGG   Cronobacter sakazakii Sp291: CSSP291_07605Help
Entry
CSSP291_07605     CDS       T02461                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00740  Riboflavin metabolism
csz00790  Folate biosynthesis
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz02024  Quorum sensing
Module
csz_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CSSP291_07605 (ribA)
   00790 Folate biosynthesis
    CSSP291_07605 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CSSP291_07605 (ribA)
Enzymes [BR:csz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CSSP291_07605 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AGE86116
Position
complement(1587226..1587819)
Genome map
AA seq 197 aa AA seqDB search
MQLKRVAEAKLPTPWGDFLMVGFEELATGQDHVALVFGDISGTEPVLARVHSECLTGDAL
FSLRCDCGFQLEAALSHIAEAGRGVLLYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLGVDEVRLLTNNPRKVEILTEAGINIVERVPLIVGRNPKNE
HYLDTKAAKMGHLLSGN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaaacgtgtggcagaagccaaactgccaaccccctggggcgatttcctgatg
gtgggttttgaagaactggcaaccggacaggatcacgtagccctggtatttggtgatatt
tcaggcactgagccggtgctggcccgtgtgcactcagaatgcctgaccggcgacgcgctg
tttagcctgcgctgcgactgcggcttccagctggaagcggcgctgtcgcacattgcggaa
gccgggcgcggcgtgctcctctatcatcgccaggaggggcgtaatattggtctgctgaat
aaaatccgcgcctatgcgttgcaggatcagggctacgataccgtcgaagcgaaccatcag
ctcggctttgccgccgacgaacgcgatttcaccctgtgtgcggacatgtttaagctgttg
ggcgtggatgaagtgcgcctgctcactaacaacccgcgcaaggtggagatcctgaccgaa
gcgggaattaatatcgttgagcgcgtaccgctgattgtcggacgtaacccgaaaaacgag
cactatctcgataccaaagccgccaaaatggggcatctgctctccggtaactga

DBGET integrated database retrieval system