KEGG   Cronobacter sakazakii Sp291: CSSP291_08345Help
Entry
CSSP291_08345     CDS       T02461                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00010  Glycolysis / Gluconeogenesis
csz00071  Fatty acid degradation
csz00350  Tyrosine metabolism
csz00625  Chloroalkane and chloroalkene degradation
csz00626  Naphthalene degradation
csz00680  Methane metabolism
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01120  Microbial metabolism in diverse environments
csz01130  Biosynthesis of antibiotics
csz01200  Carbon metabolism
csz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSSP291_08345
  09102 Energy metabolism
   00680 Methane metabolism
    CSSP291_08345
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSSP291_08345
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CSSP291_08345
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CSSP291_08345
   00626 Naphthalene degradation
    CSSP291_08345
Enzymes [BR:csz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CSSP291_08345
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CSSP291_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AGE86264
Position
1722691..1723809
Genome map
AA seq 372 aa AA seqDB search
MKSRAAVAFGPGKPLEIVEIDVAPPKKGEVLVKITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGGGVVVEVGEGVTSLKPGDHVIPLYTAECGECKFCKSGKTNLCQAVRATQGKGLMPD
GTTRFSYNGEPVYHYMGTSTFSEYTVCAEISLAKVNPQAPLDKVCLLGCGVTTGIGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRILAIDTNPEKFKLAGEMGATDFVNPKD
YDKPIQDVIVEMTDGGVDFSFECIGNVNVMRAALECCHKGWGESVIIGVAGAGQEIKTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEDAMAGKIRLDPFITHRLPLEKINEAFDLMHEG
KSIRTVIHFGDK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgcagcagtcgcatttggcccgggcaaaccgctggaaatcgttgagatt
gacgtcgcgccgccgaaaaagggcgaagtgctggtcaaaattacccacaccggcgtgtgc
cacaccgatgcgttcacgctctccggcgacgatccggaaggcgtcttcccggcggtgctc
ggtcatgaaggtggcggcgtggtcgtggaagtgggcgagggcgtcaccagcctgaagccg
ggcgaccatgtgatcccgctctataccgctgagtgcggcgagtgcaaattctgtaaatcc
ggtaaaaccaacctctgccaggccgtacgcgccacccagggcaaaggcctgatgccggac
ggcaccacccgtttctcttacaacggcgagccggtttatcactatatgggcaccagcacc
ttcagcgaatacaccgtctgcgccgagatttcattggcgaaagtgaacccgcaggcgccg
ctcgataaagtctgcctgctgggctgcggcgtcaccaccggtatcggcgcggtgcataac
accgccaaagtgaaagagggcgacaccgttgccgtgttcggcctcggcggtattggcctt
gcggtaatccagggcgcggtacaggcgaaggccgggcgcattctggccatcgacaccaac
ccggagaaattcaagctggcgggtgaaatgggcgcgaccgatttcgttaacccgaaagat
tacgacaagccgattcaggacgttatcgttgagatgaccgatggcggcgtcgatttcagc
ttcgagtgcatcggcaacgtcaatgtgatgcgcgctgcgctggaatgctgccataaaggc
tggggtgaaagcgttatcatcggcgtggcgggcgcaggccaggagatcaaaacgcgtccg
ttccagctggtgacaggccgcgtctggcgcggttcggcgttcggcggcgtgaaagggcgc
acccagctgccgggcatggtggaagacgcgatggcgggcaagattcgcctcgatcctttc
atcacccaccgcctgccgcttgagaaaatcaacgaggcgtttgacctgatgcacgaaggc
aaatcgattcgtaccgttatccacttcggcgacaaataa

DBGET integrated database retrieval system