KEGG   Cronobacter sakazakii Sp291: CSSP291_12905
Entry
CSSP291_12905     CDS       T02461                                 

Definition
(GenBank) hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
csz  Cronobacter sakazakii Sp291
Brite
KEGG Orthology (KO) [BR:csz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csz02044]
    CSSP291_12905
Secretion system [BR:csz02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   CSSP291_12905
SSDB
Motif
Pfam: ImpE
Other DBs
NCBI-ProteinID: AGE87164
Position
complement(2712228..2713025)
AA seq 265 aa
MTTEITFKDLLNRAAFDAHFNATTSRLKAQPDNSAARELLFKFYCLEGDWHNALTHLEIL
KALDAEYTKRVELYKNLVMSEILRARVLAGDITPAGLTEPLPEWVALLHEANRQFAAGED
EDAERLRQQAFDLAPLTAGEGEEIAPFSWMADSDGRLGPVCEFICAGGYRWVPFSALRAL
KIHRPVDLLDLLWLPAQVTLADGQFQGYIPARYPLTPQATQETRLGSLTDWQPVSESLCI
GLGRKMLITDNADYALPDLRELRFY
NT seq 798 nt   +upstreamnt  +downstreamnt
atgacgacagaaatcacgtttaaggacttacttaatcgcgcggcgtttgacgcccatttc
aacgcaacgacgagccgcttaaaagcgcagcctgataacagcgcggcgcgcgaattgctg
tttaaattttattgtctcgaaggcgactggcataacgctctgacgcacctggagatactg
aaagcgctcgatgcggaatatacaaagcgggtggagctttataaaaatctcgttatgagc
gaaatattacgcgcccgcgtgctggccggtgacattacgccggcggggcttacggagccg
ctgccggaatgggtcgcgctgcttcatgaggcgaaccggcagttcgctgctggtgaagac
gaggatgccgaacgcctccgtcagcaggcattcgacctggcaccgcttacggcgggcgaa
ggcgaggagatagccccgtttagctggatggccgacagcgacggacgactcgggcccgtg
tgcgaatttatctgtgcgggagggtatcgctgggtgccgttttccgcgctgcgtgcgctg
aagatccaccgtcccgttgacctgctggatctgctctggctgcctgcgcaagtgactctc
gctgacgggcagtttcagggctatatcccggctcgctacccgctgacgccgcaagcgacg
caggaaacccgtctcggcagcctgaccgactggcagccggtcagcgagtcgctctgtatc
gggcttggcagaaagatgctgattaccgataacgcggactatgcgctgccggatctgcgt
gagcttcggttttattaa

DBGET integrated database retrieval system