KEGG   Cronobacter sakazakii Sp291: CSSP291_16390Help
Entry
CSSP291_16390     CDS       T02461                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00052  Galactose metabolism
csz00500  Starch and sucrose metabolism
csz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CSSP291_16390
   00500 Starch and sucrose metabolism
    CSSP291_16390
Enzymes [BR:csz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CSSP291_16390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGE87847
Position
3476177..3477586
Genome map
AA seq 469 aa AA seqDB search
MTTRTLLPAILQAVMKGQPVALGDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWNP
LGCAHQHKCWGHWSSADLTHWQHEPLALMPDEEYDRGGCYSGSAVDDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHGEHWYMVLGAQDLA
LQGKVLLLRSDTLWNWENLGEIAGSTLGGLGEAGYMWECPDLFMLDGKAILITCPQGVAR
EEKRYLNTYPSAYLCGDLNYDTPEFRHGPLMELDAGFEFYAPQTTLADDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELTLRDGLLCQQPVRELAALRGEEQRLEGVAATLSPL
AAESLELMLEAQGDVTLDFAATLRLEWTRDGLRLARRSLATGEWQYRYWQGDARRLHILC
DRSSVEIFINDGEGVMSSRYFPAANATLGFEGDAHLRLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcacgctgctgcctgccattttacaggctgtgatgaaaggccagccggtc
gcgcttggcgatcgccactacccgcgctggcacctggccccggtgacgggtctgatgaac
gacccaaacggttttatccattttcaggggcgctaccacctgttttatcagtggaacccg
ctgggctgtgcgcatcagcataaatgctgggggcactggagctcggcggatctgacgcac
tggcaacacgagccgctggcgctgatgccggatgaagagtatgaccgcggcggctgttat
tccggcagcgcggtggatgacaacgggcgactgacgctctgttacaccggcaacgtgaag
tttgatgacggcacccgcaccgcctggcagtgtctggcggtgcagaacgcggatggcggt
tttgacaagctcggcccggtgatgccgctgcccggcggctataccggccacgtgcgcgac
ccgaaagtctggcgtcacggcgagcactggtacatggtgctgggcgcgcaggatctggca
ttgcagggcaaagtgctgctgctgcgatccgacactctgtggaactgggaaaacctgggc
gagatcgccggcagcacgctcggcgggcttggcgaggcgggttacatgtgggagtgcccg
gatctcttcatgctggatggcaaagcgattctgatcacctgtccgcagggggtggcgcgc
gaagaaaaacgctatctcaacacctatccgagcgcgtacctgtgcggcgatctcaattac
gacacgccggaatttcgtcacggcccgctgatggagctggacgccggttttgagttttac
gcgccgcaaaccacgctggccgacgatggccgccggttactcatcggctggatgggcgtg
ccggacggcgaagagatgttgcagccgacggtggcgcagggctggatccaccagatgacc
tgcccgcgcgaactgacgcttcgcgatggcttgctctgccagcagccggtacgcgaactt
gccgcgctgcgcggcgaggaacagcgcctggagggcgtggccgccacgctctcaccactc
gcggcggaaagcctggagctgatgctggaggcgcagggcgacgtcacgctcgatttcgcc
gccactctgcgcctggaatggacgcgcgacggtctgcgccttgcgcgccggagcctcgcc
accggcgaatggcagtatcgttactggcagggcgacgcccgccgcctgcatattctgtgc
gaccgttccagcgttgagattttcattaacgacggcgaaggcgtgatgagcagccgctat
ttcccggcggccaacgcgacgcttggttttgaaggcgacgcgcatctccggctgcgctac
tggtcgttacgcgcctgcatggtagaatga

DBGET integrated database retrieval system