KEGG   Cronobacter sakazakii Sp291: CSSP291_17395Help
Entry
CSSP291_17395     CDS       T02461                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00860  Porphyrin and chlorophyll metabolism
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01120  Microbial metabolism in diverse environments
Module
csz_M00121  Heme biosynthesis, glutamate => heme
csz_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CSSP291_17395 (hemD)
Enzymes [BR:csz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CSSP291_17395 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGE88048
Position
3699842..3700582
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPAGEELVSRLRALGQEAWTFPLIEFCPGRELPQLPALLDALAPHDLLFALS
QHAVSFANAHLQRLGLRWPRAVEAFAIGRTTALALHQVSGLHVHYPRDREISEVLLQLPE
LQNVAGKRALILRGNGGRELLGETLTERGATVTFCECYQRSAKIYDGTEEAHRWHTRGIT
TLVVTSGEMLRQLHDLMPPWYRENWLLRCRLVVVSERLATIARELGWQNILVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggtcacccgcccctctcccgccggggaggaattagtgagccgcctgcgc
gcactggggcaggaggcctggacttttccgctgatcgagttctgccctggccgggagttg
ccgcagttgcccgcgctgctcgacgcgctcgcgccgcacgatctcctctttgcgctgtcg
caacacgcggtgagttttgcgaacgcgcatttacagcgtctggggctgcgctggcctcgc
gccgtcgaggcgttcgccatcgggcgtaccaccgcgctggcgctgcatcaggtcagcggt
ttgcacgtccattacccgcgcgatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaacgttgccggtaagcgtgcgcttatcctgcgcggcaacggcggacgcgaactg
ttaggggaaaccttaacggagcgcggcgcgaccgtgacgttttgcgaatgctatcaacgt
agcgcgaaaatttacgacggcaccgaggaagcgcaccgctggcatacgcgcggcattacc
acgctggtggtgacgagcggcgagatgctgcgccagctgcatgacctgatgccgccgtgg
tatcgcgaaaactggttgctgcgctgtcggctggtggtcgtcagcgagcgtctggcgacg
attgccagggagcttggctggcagaacattctggtcgctgataacgccgataacgacgcg
ctgctgcgcgcgttgcaataa

DBGET integrated database retrieval system