KEGG   Cronobacter sakazakii Sp291: CSSP291_17925Help
Entry
CSSP291_17925     CDS       T02461                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00051  Fructose and mannose metabolism
csz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CSSP291_17925
Enzymes [BR:csz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CSSP291_17925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh AfaD 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGE88152
Position
3836619..3837767
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIGLTFADVNQTVLDALNARHSYQVRVVGEQEQIDTV
SGVDAVNSTSEDVVTLIATVDLVTTAVGPVVLERIAPAIAKGLALRKAQGNERPPNIIAC
ENMVRGTSQLKTHVFNALAEGDKAWVESHVGFVDSAVDRIVPPSASAAHDPLEVTVETFS
EWIVDKTQFKGELPTIAGMELTDNLMAFVERKLFTLNTGHAITAYLGKQAGHQTIRDAIL
DEKIRLVVRGAMEESGAVLIKRYGFDDAKHAAYIEKILSRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHQNLVLGIAAAMHFRSEDDPQAQELAQLIADKGPQAALAQ
ISGLDANSDVVALAVNAYNATA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatattggtcgtggctttattggcaaactgctc
gctgacgcaggcattggcctgacgttcgccgacgtgaaccagacggtgctggacgcgtta
aacgcgcgccacagctatcaggtgcgcgtggtgggcgagcaggagcagattgataccgtt
tccggcgtggatgcggttaacagcaccagcgaggatgtcgtgacgcttatcgccacggtc
gatctcgtgacgaccgccgttggcccggtggtactggagcgcatcgctccggcgattgcc
aaaggtctggcgctgcgtaaagcgcagggcaacgagcgcccgcccaatatcatcgcctgt
gaaaacatggtgcgcggcaccagccagctgaaaacgcatgtctttaacgcgctcgcagag
ggcgacaaagcctgggtggaaagccacgtcggttttgttgactcggccgttgaccgtatc
gtgccgccgtcggcatccgccgcgcacgatccgctggaagtcaccgtggaaaccttcagc
gagtggattgtcgataaaactcagttcaaaggcgagctgccgaccatcgcaggcatggag
ctgaccgacaatctgatggcatttgttgaacgcaagctcttcaccctgaacaccgggcat
gctataaccgcctacctcggaaaacaggccggtcatcagaccattcgcgacgcgattctg
gatgagaaaattcgtctggtggtgcgcggcgcgatggaagagagcggcgcggtactgatt
aaacgctacggctttgatgacgcgaaacatgccgcgtatatcgagaaaatccttagccgt
tttgaaaacccgtacctgaaagacgatgtggagcgcgttggccgtcagccgctgcgcaaa
ctgagcgcgggcgaccgtctgattaaaccgctgctgggcacgctggaatatggcctaccg
catcagaatctggtactgggtatcgccgccgcgatgcatttccgcagcgaagacgatccg
caggcgcaggagctggcgcagcttatcgccgataaaggcccgcaggccgcgctggcgcag
atttccggtctggacgccaacagcgatgtcgtggctttggcagtaaacgcgtataacgca
acagcgtaa

DBGET integrated database retrieval system