KEGG   Cronobacter sakazakii Sp291: CSSP291_18180
Entry
CSSP291_18180     CDS       T02461                                 

Definition
(GenBank) type VI secretion system FHA domain-containing protein
  KO
K07169  FHA domain-containing protein
Organism
csz  Cronobacter sakazakii Sp291
Brite
KEGG Orthology (KO) [BR:csz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    CSSP291_18180
SSDB
Motif
Pfam: FHA UreE_N Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AGE88199
Position
complement(3890517..3892433)
AA seq 638 aa
MRFTITTNKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNERTISRLQAIVHISADGEC
RITNRGNVTRVVLNDIPLERGRQVELQDGDVLGIDDYRIQVSDLALNAQPVIAMAAPKPN
VAPQQPQAPQPAKPQQPPKADAQDNAPTAVPTEIWDSLMQEFSISDSISQGQSQSARPKT
PEAQPFNPFNAPKEADRNPEDPLAHFQSGGNEPLFGNERVNPDSLFKDDTPFDKDSIFND
VTPTTLVPPSDNRQAAKPQAPHKENEEELDPLALFGGVGSTPVQSRSDDPLGLMMGGAVP
LTPPDELNAGAAPLTPPPAAKQDAEPVKPPVSPEKPQPEMTTSPLAPNADDSIDLASLAA
SPLFPEEVPEEPVTRVEVQPTPPEVQDYAGITLPTPQAVARSTAQTPKGRLRIDPVQSPT
SQGGTPTASNGDVLNGELLEALLEGMGLGELQPTPQFDRDNMRQLGQMLSMFSQGTVALL
SSRSILKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGFMPPKKSVRDALIDL
QAHQLGMIAGIRAIIAAMLQSFNPEQLEEEAKRDGAISRLALPASRKAALWDYFVRHYSD
TAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQSGSEEE
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgcgattcacgattactaccaacaagcccggccaccagcctcctcagagcagctgtgac
ttctacccgccgggcggcacgattggccgtggtacggataacaatctggtactgccggat
aatgaaagaacgatttcccgcctgcaggcgattgtccatatctccgcggacggcgagtgc
cgcatcactaaccgcggcaacgtgacccgcgtggtgctgaacgatattccgctcgagcgc
ggccgccaggtggagttacaggatggcgacgtgctcggcattgacgattaccgcatccag
gtcagcgatctggcgctgaacgcgcagccggttatcgcgatggccgcgccgaaaccgaac
gttgcgccgcagcagcctcaggcaccgcagcctgcgaaaccgcagcagccgccgaaagcc
gacgcgcaggacaacgcgccaacggcggtgccgaccgaaatctgggacagcctgatgcag
gagttctctatctccgacagcatcagccagggtcagagccagagcgcgcgcccgaaaaca
ccggaagcgcagccgtttaacccgttcaacgccccgaaagaggcggatcgcaacccggaa
gatccgctggcgcacttccagagcggcggcaacgagccgctgttcggcaatgaaagggtc
aacccggacagcctgttcaaagatgacacgccgttcgataaagacagcattttcaacgat
gtgacgccgaccacgctggtgccgccgtctgataaccgtcaggccgcaaaaccgcaggca
ccgcataaagagaatgaagaagagctcgatccgctggcgctgtttggcggcgtgggttcc
acgccggtacagagccgcagcgacgatccgcttggcctgatgatggggggcgctgtgccg
ctgacgccgccggatgagcttaacgcaggcgctgcgccattaacgccgccgcccgccgcg
aagcaggacgccgagccggttaagccaccggtttcacccgaaaaaccgcagccggagatg
acgacctcgccgctcgcgccaaacgcggacgactcaatcgatctggcgtcgctcgccgct
tcgccgctattcccggaagaagtgccggaagagccggtgacgcgcgtggaagtccagccg
acgccgccggaagtgcaggattacgcgggtatcacgctgccgacgccgcaggcggtggcg
cgcagcaccgcgcagacgccaaaaggccgcctgcgcatcgacccggtgcagtcgccaacc
agccagggcggcacaccgacggcgtctaacggcgacgtgctgaacggcgagctgctggaa
gcattgctggaaggtatggggcttggcgagctgcaaccaacgccgcagtttgaccgcgac
aatatgcgccagctcggccagatgctcagcatgttctcgcagggcaccgtggcgctgctc
tcctcgcgctcgattctcaagcgcggcgtgaaagccgatatgacgatggtgctggacgac
gccaacaacccgttcaagctgctgccgtcaggcaaaaccgtgctgatgcagatgttcggc
acccgtatgccgggctttatgccgccgaaaaaatcggtgcgcgacgcgcttatcgatctt
caggcgcaccagctcgggatgatcgccggtatccgcgccatcatcgccgccatgctgcaa
tcctttaacccggagcagcttgaagaagaggcgaaacgcgacggcgctatctcgcgtctg
gcgctgccggcgagccgcaaagccgcgctgtgggattactttgtgcgtcattacagcgat
accgcgggcgagatcgaggacgatttccatactctgttcggcgaagccttcctgcacgct
tatgacatggaagtgaatcagtacaaagactcacaaagcggatcggaagaagaatga

DBGET integrated database retrieval system