KEGG   Chlamydia trachomatis A/HAR-13: CTA_0660Help
Entry
CTA_0660          CDS       T00280                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
cta03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CTA_0660 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cta03400]
    CTA_0660 (ung)
Enzymes [BR:cta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     CTA_0660 (ung)
DNA repair and recombination proteins [BR:cta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CTA_0660 (ung)
 Prokaryotic Type
     CTA_0660 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AAX50884
UniProt: Q3KL88
Position
complement(689039..689728)
Genome map
AA seq 229 aa AA seqDB search
MHEAFTIEQLPPSWQEQLKDEWSQPYWSQLLAFLKSEYAQATIYPKKENVFAALQSTPFD
QVRVVILGQDPYHGEGQAHGLSFSVPRGQALPPSLRNIFQELHTDLGIRNESGCLQAWAD
QGVLLLNTVLTVRAGEAFSHAGRGWERFTDAIVTKLIQNRTHVIFVLWGNAARQKCNLLF
QTKHQHAVLACPHPSPLAAHRGFFGCCHFSKINYLLKKQGKTMINWKIE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggcttttactatagagcaactccccccgtcttggcaagaacagcttaaagat
gaatggtctcagccttattggtcccagttgcttgcttttttaaaaagtgaatacgcacaa
gcaacgatctaccctaaaaaagaaaatgtttttgcagctttgcagagtactcctttcgat
caagtgcgggtagtgattcttggacaagatccgtatcatggagaagggcaggcgcacggc
ttgagttttagtgttcctagagggcaggcattacctccatctttgcgtaatatttttcag
gaactccataccgatttagggattcgtaatgaatctgggtgtttgcaagcctgggcagat
caaggtgttcttcttttgaacaccgtgctcacagttcgcgcaggggaagccttctctcat
gcaggacgaggatgggaacgttttaccgatgctattgtgactaaattaattcaaaataga
acgcacgtaatctttgttttatgggggaatgctgcgcggcaaaaatgtaatctgcttttc
cagactaagcatcaacatgcggttcttgcttgcccgcatccgtctccactggctgcacat
agagggttctttgggtgttgccacttttcaaaaattaattatctgcttaaaaaacaggga
aagacgatgattaattggaagatagaatga

DBGET integrated database retrieval system