KEGG   Clostridium taeniosporum: BGI42_00805Help
Entry
BGI42_00805       CDS       T04957                                 

Definition
(GenBank) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
ctae  Clostridium taeniosporum
Pathway
ctae00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ctae00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BGI42_00805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctae01007]
    BGI42_00805
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ctae03016]
    BGI42_00805
   03029 Mitochondrial biogenesis [BR:ctae03029]
    BGI42_00805
Enzymes [BR:ctae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     BGI42_00805
Amino acid related enzymes [BR:ctae01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BGI42_00805
Transfer RNA biogenesis [BR:ctae03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BGI42_00805
Mitochondrial biogenesis [BR:ctae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BGI42_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b Ish1 Zn_Tnp_IS1595 zinc_ribbon_15
Motif
Other DBs
NCBI-ProteinID: AOR22356
UniProt: A0A1D7XG82
Position
179701..181092
Genome map
AA seq 463 aa AA seqDB search
MAVEKTMDKIVALCKNRGFVFPGSDIYGGLANSWDYGPLGVEFKNNVKKAWWKKFVQESH
YNVGLDSAILMNSEVWAASGHIGGFSDPLMDCKECKARFRADKIVEDHMTENGAEVASAD
GWTNEELKEYIEKNNIVCPKCGKMNYTDIRKFNLMFKTFQGVTEDAKSEIYLRPETAQGI
FVNFKAVQRSSRKKVPFGIAQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGTDLEWH
KYWKEYCWNFLLNLNVKSENLRMRDHGEEELSFYSNATSDIEYLFPFGWGELWGIADRTD
YDLTKHQEHSGQDLNYLDQTTNEKYIPYVIEPSLGADRVTLAFLVEAYDEEELEGGDSRT
VLHFHPALAPFKAAILPLSKKLSENALDVYSELSKKFNIDFDETGSIGKRYRRQDEIGTP
YCITIDFDTLEDGCVTVRDRDTMEQERIKISELESYIGKSLEF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaaaaaacaatggataagattgtagctctttgtaaaaatagaggttttgta
ttcccaggctcagatatatatggtggattagctaactcatgggattacggtcctttagga
gtagaatttaagaataatgttaaaaaagcttggtggaagaaattcgtacaagaaagtcat
tataatgtaggacttgattcagctattttaatgaacagtgaagtttgggcagcatctggt
cacataggtggattttctgatccgttaatggattgtaaagaatgcaaagctagatttaga
gctgataaaatagttgaagatcatatgactgaaaatggtgcagaagtagcatcagctgat
ggatggactaacgaagaattaaaggaatatattgaaaaaaataatatagtgtgtcctaag
tgtggaaagatgaactatacagatataagaaagtttaatcttatgtttaaaacattccaa
ggtgttactgaagatgctaaatcagaaatttatttaagacccgaaacagcacaaggtata
tttgtaaactttaaagctgttcaaagaagctctagaaagaaagtaccttttggaatagct
caaataggtaaatcatttagaaatgaaattactccaggaaactttacatttagaacaaga
gaatttgaacaaatggaattagaatttttctgtaaaccaggaactgatttagaatggcat
aagtattggaaggaatattgttggaatttcctacttaacttaaatgtaaaatctgaaaac
ttaagaatgagagatcatggggaagaagaattatcattctattctaacgcaacttctgat
atagaatatttattcccatttggttggggtgaactttggggtatagctgatagaacagat
tatgatttgactaagcaccaagagcattcaggtcaagatttaaattatttagatcaaact
actaatgaaaaatatataccttatgttatagaaccatcattaggagctgatagagttaca
ttagcattcttagtagaagcctatgatgaagaagaattagaaggaggagattctaggact
gtattgcattttcatccagcactagctccatttaaggcagctatattacctctttctaaa
aagctttcagaaaatgctctagatgtttattctgaattaagtaagaaatttaatattgat
tttgatgaaacaggaagtataggaaagagatatagaagacaagatgaaataggaactcct
tactgtataacaatagattttgatacattagaagatggatgtgttactgtaagagataga
gatactatggaacaagaaagaattaagatatctgaattagaatcttatataggaaaaagt
ttagaattttaa

DBGET integrated database retrieval system