KEGG   Clostridium taeniosporum: BGI42_02220Help
Entry
BGI42_02220       CDS       T04957                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctae  Clostridium taeniosporum
Pathway
ctae00071  Fatty acid degradation
ctae00072  Synthesis and degradation of ketone bodies
ctae00280  Valine, leucine and isoleucine degradation
ctae00310  Lysine degradation
ctae00362  Benzoate degradation
ctae00620  Pyruvate metabolism
ctae00630  Glyoxylate and dicarboxylate metabolism
ctae00640  Propanoate metabolism
ctae00650  Butanoate metabolism
ctae00900  Terpenoid backbone biosynthesis
ctae01100  Metabolic pathways
ctae01110  Biosynthesis of secondary metabolites
ctae01120  Microbial metabolism in diverse environments
ctae01130  Biosynthesis of antibiotics
ctae01200  Carbon metabolism
ctae01212  Fatty acid metabolism
ctae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BGI42_02220
   00630 Glyoxylate and dicarboxylate metabolism
    BGI42_02220
   00640 Propanoate metabolism
    BGI42_02220
   00650 Butanoate metabolism
    BGI42_02220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BGI42_02220
   00072 Synthesis and degradation of ketone bodies
    BGI42_02220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BGI42_02220
   00310 Lysine degradation
    BGI42_02220
   00380 Tryptophan metabolism
    BGI42_02220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BGI42_02220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BGI42_02220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BGI42_02220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctae04147]
    BGI42_02220
Enzymes [BR:ctae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BGI42_02220
Exosome [BR:ctae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGI42_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOR22599
UniProt: A0A1D7XHN8
Position
451802..452983
Genome map
AA seq 393 aa AA seqDB search
MKEVVIVSAVRTALGSFSGSLKGVPAVELGATVIKEAVNRAGIKPEVVEEVLMGNVIQAG
LGQNPARQSAVKAGLPVEVPAMTINKVCGSGLRTVSLAAQMIKAGDADVIVAGGMENMSA
APYVLPGARWGQRMGDAKMVDTMIKDGLWDAFNNYHMGVTAENIAKQWGLTREEQDAFSA
SSQQKAQKAIETGRFKDEIVPVMIPQRKGEPKVFDTDEFPRFGTTPETLAKLRPAFLKEG
TVTAGNASGINDGAAAFVVMSAEKAAELGVKPLAKIVSYGSKGLDPSIMGYGPFHATKKA
LEEADLTIDDMDLIEANEAFAAQSLAVAKDLKFDMEKVNVNGGAIALGHPVGASGARILV
TLLYEMEKRDAKKGLATLCIGGGMGTAVIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttattgtaagtgcagtaagaacagctcttggaagctttagtggatca
ttaaaaggtgttccagcagtagaattaggagcaactgtaattaaagaagctgtaaacaga
gctggtataaagccagaagttgttgaagaagttttaatgggtaatgttatccaagctggt
ttaggacaaaatccagctagacaatcagctgttaaagctggattaccagtagaagttcca
gcaatgacaataaataaagtttgtggttcaggattaagaacagttagtttagcagctcaa
atgataaaagcaggagatgctgatgttatagttgctggtggtatggaaaatatgtcagca
gcaccatacgtattaccaggtgctagatggggtcaaagaatgggtgacgctaaaatggta
gatactatgataaaagatggattatgggatgcatttaacaactatcatatgggtgttact
gctgaaaatatagcaaaacaatggggattaactagagaagaacaagatgctttctcagct
tcatctcaacaaaaagctcaaaaagctattgaaactggaagatttaaagatgaaatagtt
ccagttatgattccacaaagaaagggagaaccaaaagtatttgatactgatgaattccca
agattcggaacaactccagaaactttagccaaattaagaccagctttccttaaagaagga
acagtaacagcaggtaatgcttcaggaataaatgatggagcagcagcatttgttgttatg
agcgctgaaaaagcagctgaattaggagttaaaccattagctaaaatagtttcttatgga
tcaaaaggattagacccatctataatgggatacggaccattccatgcaactaagaaagct
ttagaagaagctgacttaacaattgacgatatggacttaattgaagctaatgaagccttt
gcagctcaaagtttagcagttgctaaagacttaaaattcgatatggaaaaagttaatgtt
aatggaggagctattgcattaggacatccggttggagcatctggtgctagaattcttgtt
acattactttatgaaatggaaaagagagatgctaaaaaaggtttagcaacactttgcata
ggtggaggaatgggaactgctgttatagttgaaagactataa

DBGET integrated database retrieval system