KEGG   Clostridium taeniosporum: BGI42_03100
Entry
BGI42_03100       CDS       T04957                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ctae  Clostridium taeniosporum
Pathway
ctae00230  Purine metabolism
ctae01100  Metabolic pathways
ctae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctae00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BGI42_03100
Enzymes [BR:ctae01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BGI42_03100
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AOR22759
UniProt: A0A1D7XI38
Position
638168..640468
AA seq 766 aa
MTKNIVGSSVIRCDAVAKVTGKAKYVDDFFVSDMLIGKVLRSPYAHAIVKNIDTSKAKAL
EGVEAVITYEDLPKIKFGTAGHPWSLDPNHRDIEDRLILTNKARFVGDAIAAVVAVDEII
ATKALELIDVNYDVLEPIINSEDALKENAPIIHEERPDNILSSFGSEIGNVEEDFKKADR
IFEGNFETSIVQHCHMENHSAYAYVDSEDRIVIVSSTQIPHIVRRVAGQALGIPWGKIKV
IKPYVGGGFGNKQDIVLEPLTAAMSLAVDGRPVKYTLDREECFIDTRTRHSMKIKFKTAV
SKEGKLLSLDIKNLVNNGAYASHGHSVALSAGGKFRGVYDFKSIKYSPITVYTNLPAAGA
MRGYGAPQMCYALESHIEDICKALNVDPIEFRIKNFVNEGYVEPLSKNSVRSFALPQCME
KGKELIKWNEKKKEYKEYNAENKDKKRGVGMACFSYFTGTHPVSLEPAGARIVMNQDGSV
QLQIGATEIGQGSDTVFGQMVAEILGLKIDMVHVISMQDTDITPFDTGSYASRQTFVSGA
AVKKCALEVRGKVLEFASSKCGLQPSELDIVDCKIIEKKLGRIICPLEEIAMESYYDRIK
CCPITSDTSVNVRINAIAYGATFVAVEVDIKTGKIDVLEIYNIHDSGMIMNPMLAEGQVH
GGVSMGLGYALSEQMLFDEKTGKPLNNNLLDYKLQTIMDTPTIGSAFIQKYEPAGGFGQK
SIGENTTVSPAPAVRNAVLDATGVAFNKIPMNPQSVFEKFNQVGLV
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgactaagaatatagtagggagtagtgtaattcgatgtgatgctgtggccaaagttact
gggaaagcaaagtatgtggatgatttttttgtaagtgatatgttgataggtaaagtttta
aggagcccttatgctcatgctatagttaaaaatatagatactagtaaggcaaaagcgtta
gaaggtgtagaagcagttattacttatgaagatttacccaaaattaaatttggtactgct
ggtcatccctggtccttagatcctaatcatagagatatagaggataggttaattcttact
aataaagctagatttgttggagatgcaatcgcagcagtagtagcagtagatgaaataata
gcaacaaaagctttagaacttatagatgttaattatgatgttcttgaaccaataataaat
agtgaggatgctttaaaagaaaatgcaccaataattcatgaggaaagaccagataatatt
ttaagttcttttggatcagaaattggaaatgtagaagaagattttaaaaaagcagataga
atatttgaaggaaattttgaaactagtatagttcaacattgtcatatggaaaatcatagt
gcttatgcctatgtagatagtgaggatcgtatagttatagtttcttcaactcaaattcct
catattgtaagaagagttgcaggacaagctcttggaataccttggggaaaaataaaagtt
attaagccttacgttggtggtggatttggaaataaacaagatatagttcttgaaccatta
actgcagctatgtctcttgccgttgatggaagaccagttaagtatacattagatagagaa
gaatgttttattgatacaagaacaaggcattctatgaaaattaaatttaaaaccgcagta
tcaaaggagggaaaattattatcattagatataaagaatcttgtaaataatggagcttat
gcatcacatggtcattctgttgctttaagtgctggtggaaaatttagaggtgtatatgat
tttaaatcaataaaatatagcccaataacagtatatacaaacttaccagcagcaggtgca
atgagaggatatggagcaccacaaatgtgttatgcattagaaagtcatatagaagatata
tgtaaagcccttaatgttgacccaatagaatttaggattaaaaattttgttaatgaaggt
tatgttgaaccacttagtaaaaattcagttcgttcttttgcattaccacaatgtatggaa
aaaggtaaagaattaattaaatggaatgaaaaaaagaaagaatataaagagtataatgct
gaaaataaggataaaaaaagaggcgtaggtatggcgtgctttagttattttactggaaca
catcctgtatcgttagaaccagctggagcaagaattgtaatgaatcaagatggatcagtt
caattacagataggagcaaccgaaataggtcaaggaagtgatacagtttttggtcaaatg
gtggctgaaattcttggattaaaaatagatatggtacatgttatttctatgcaagataca
gatataactccttttgatacaggctcatatgcatcaagacaaacatttgtaagtggagca
gcagttaagaagtgtgcattagaagttagaggtaaagtgttagaatttgcaagtagtaaa
tgtggattacaacctagtgaactagatattgtagattgtaaaatcatagaaaaaaaatta
ggtaggataatatgtccacttgaggaaattgctatggaatcatattatgatagaattaaa
tgctgccctataactagtgacacatcggttaatgttagaattaatgcaatagcatatgga
gctacttttgtagcagtagaagttgatatcaagacaggtaagatagatgttttagaaata
tataatatacatgattcaggtatgattatgaatcctatgttggctgaaggacaagtacat
gggggagtaagtatgggacttggatatgctttatcagaacaaatgttatttgacgagaaa
actggtaagccattaaataataatcttttagattataaattacaaacaataatggatact
cctactattggatcagcatttattcaaaaatatgaaccagcaggtggatttggtcaaaaa
tctattggagaaaatactacagtttcaccagcaccagctgttcgtaacgctgttttagat
gctactggtgttgcatttaataaaataccaatgaatccacaatctgtttttgaaaaattc
aatcaagttggattagtgtag

DBGET integrated database retrieval system