KEGG   Clostridium taeniosporum: BGI42_03190Help
Entry
BGI42_03190       CDS       T04957                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ctae  Clostridium taeniosporum
Pathway
ctae00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ctae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BGI42_03190
Enzymes [BR:ctae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BGI42_03190
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BGI42_03190
    1.1.1.-  
     BGI42_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ApbA Oxidored_nitro PALP 2-Hacid_dh_C ADH_zinc_N_2 NAD_binding_7 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AOR22775
UniProt: A0A1D7XHE2
Position
658096..659169
Genome map
AA seq 357 aa AA seqDB search
MKAALWYAKKDVRVEEIEEPKITSNGVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHALS
GTTAPVVLGHEFSGDVVEVGENVTKFKVGDRVIVEPIVACGKCPACLEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFIHKIPDEMSYEQAALVEPMAVALHSIRIGNFKIGDTALVLG
SGPIGLATIECLKAAGAKLVVVLQRKSIRQEYAKRAGADVVLDPNEVDIAEEVKKLTNGL
GVDVAFETTGAQIGFDTGINSLKFEGTMVITSIWENGVTFNPNALVFTEKKIVGTLAYRH
EFPATMAQMNDGRIKAEGYITKRIHLDNIVEEGFGALTGPEKKKHVKILVTPDKDLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctttatggtacgctaaaaaagatgttagagtagaagaaattgaagaacca
aaaattacaagcaatggagtaaaaataaaagtaaaatggtgcggaatatgtggatcagat
ttacatgaatatttaggtggtcctatatttattccagtaggtcaaccccatgcgttaagt
gggacaacagctccagtagttttaggtcacgaattttcaggtgatgttgttgaagttggt
gaaaatgtaacaaaatttaaagtaggggatagagtaatagttgaacctatagttgcatgt
ggaaaatgtccagcatgtttagaaggaaaatataatttatgttcatctttaggattccat
ggactttgtggaagtggtggaggacttgctgaatatacagttttcccagaagaatttata
cataaaataccagatgaaatgtcttatgaacaagcagctttagttgaaccaatggcagta
gctttacattcaattagaataggaaattttaaaattggagatactgcattagtattaggt
tctggtccaataggattagcaactatagaatgtttaaaggcagcaggagcaaaattagta
gtagtattacaaagaaaatctataagacaagagtatgcaaaaagagcaggtgcagatgtc
gtattagatccaaatgaagttgatatagcagaagaagttaagaagcttactaatggacta
ggtgtagatgtagcatttgaaacaacaggagctcaaattggttttgatacaggtataaat
agtttaaaatttgaaggaactatggttataacaagtatatgggaaaatggagtaacattt
aatcctaatgctttagtatttactgaaaagaaaattgttggaacattagcatatagacat
gaatttccagcaactatggctcaaatgaatgatggaagaataaaagcagaaggatatata
acaaagagaatacatttagataatatagttgaagaaggatttggagcattaacaggtcca
gaaaagaagaaacacgttaagatattagtaacaccagataaagatcttttataa

DBGET integrated database retrieval system