KEGG   Clostridium taeniosporum: BGI42_05805Help
Entry
BGI42_05805       CDS       T04957                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ctae  Clostridium taeniosporum
Pathway
ctae00900  Terpenoid backbone biosynthesis
ctae01100  Metabolic pathways
ctae01110  Biosynthesis of secondary metabolites
ctae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctae00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BGI42_05805
Enzymes [BR:ctae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BGI42_05805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AOR23274
UniProt: A0A1D7XIW3
Position
1217395..1218552
Genome map
AA seq 385 aa AA seqDB search
MKKLSILGVTGSIGTQALDVIKNSNGQLKLIGATANSSVKKMIEIIEEFDPKYVGMMDKD
CAEEIKNYCDENNKSTIVLSQMEGLNKIASLEEIDIVLTSLVGMIGLEPTLKAIKAKKDI
ALANKETLVVAGEIVMSEAKKNNVKILPVDSEHSAIYQSLRGNDLKTLNKIILTASGGPF
RGKKLSDLNNVSVNDALNHPKWNMGRKISIDSATLMNKGLEVIEAHWLFDCDYDNIQVVI
HPQSIIHSMVEYCDGSIIAQLGAADMRLPIQYAFNYTERKNLIAKTLDFYEVSKLTFEKP
DLETFKPLELAFKAGKQGGLMPTILNGANEAAVALFLDEKIEFLDIFNIIEECMNTFKEE
SKKSLTLENIITLDRKIKQYVVDMK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactatctatattaggtgttacaggttcaataggaacacaggctttagatgta
ataaaaaattcaaatggacaattaaagttaattggagcaacagcaaattcatcagtaaag
aaaatgattgaaatcattgaagaatttgatcccaaatatgtgggaatgatggataaagat
tgtgctgaagaaataaaaaattattgtgatgaaaataataagtcaacaatagtattatca
caaatggaaggattaaacaaaatagcatctttagaggaaattgacatagttttgacatct
ttagttggtatgataggattagaacctactttaaaggctataaaagctaaaaaagatata
gcacttgcaaacaaagaaaccttagttgttgcaggtgaaattgttatgagtgaagctaag
aaaaataatgttaaaatacttccagttgattcagaacatagtgctatttatcaatcttta
aggggaaatgatttaaaaacactaaataagataatacttacagcttcaggggggcctttt
agaggtaagaaattaagtgatttgaataatgttagcgtaaatgatgctttaaatcatcct
aagtggaatatgggaagaaagatttctattgattcagcaacattaatgaataaaggtctt
gaagtaatagaagcacattggctttttgattgtgattatgataatatacaagttgttata
catcctcaaagtataatacattctatggttgaatattgcgatggaagtataattgcacaa
cttggagcagcagacatgagattgccaattcaatatgcatttaattatacagaaagaaaa
aatttaatagcaaagactctggatttttatgaagtatctaagttaacatttgaaaaacca
gatttagaaacatttaaaccattagaattagcttttaaagcaggaaaacaaggtggactt
atgccaactatattaaatggtgctaatgaagcagctgtagcattatttttagatgaaaaa
attgagtttttagatatttttaatattatagaagaatgcatgaatacatttaaagaagaa
agtaaaaagtctttaactttagagaatataataacattagatagaaaaattaaacaatat
gtagtagatatgaaatag

DBGET integrated database retrieval system