KEGG   Clostridium taeniosporum: BGI42_05860Help
Entry
BGI42_05860       CDS       T04957                                 

Definition
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
ctae  Clostridium taeniosporum
Brite
KEGG Orthology (KO) [BR:ctae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ctae03016]
    BGI42_05860
Enzymes [BR:ctae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     BGI42_05860
Transfer RNA biogenesis [BR:ctae03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    BGI42_05860
 Prokaryotic type
    BGI42_05860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2
Motif
Other DBs
NCBI-ProteinID: AOR23284
UniProt: A0A1D7XIX3
Position
1231025..1231900
Genome map
AA seq 291 aa AA seqDB search
MNGVLNVFKNKGMSSFDVVRKIKFLAKEKKVGHTGTLDPEAEGVLPVCLGKATKIIDYIM
DSRKVYRVKLILGKNTTTYDLEGEVTKETDASNIKEDDVKEIILSFLGEYDQIPPMYSAL
KQNGVRLYELARQGIEVEREARRINIYNISDIVFDLPYVSFEVACSKGTYIRSLCYDIGE
RLNVGATMVNLIRTETSIFKEENSVNIESLTTENIEKYLMSIEDALISYPKLTVNNSFTK
LLVNGVKVYDKRLSDEVIENDILYRVYDKKNTFIGLGKRDNKGFKIQKLLF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatggagttttaaatgtatttaaaaataagggtatgtcttcttttgatgtagttaga
aaaataaaatttctagcaaaagagaagaaagttggacatacaggaactcttgatccagaa
gcagaaggagttttaccagtttgtttaggaaaagcaactaaaattattgattatattatg
gattctagaaaagtatatagagtaaaattaatattaggaaaaaatacaactacttatgat
ttagaaggtgaagttacaaaagaaacagatgcttctaatataaaagaagatgatgtaaaa
gaaattatactttcttttttaggcgaatatgatcaaataccacctatgtattctgcgttg
aaacaaaatggtgtaagactttatgaacttgcaagacaaggaattgaagttgaaagagaa
gcaagacgtataaacatttataatattagtgatattgtttttgatttaccatatgtgtct
tttgaggttgcatgttcaaaaggcacatatataagaagtttatgttatgatattggtgaa
agattaaatgtgggagctactatggttaatttaataagaacggaaacttctatatttaaa
gaagaaaatagtgttaatattgaaagtttaacaactgaaaatattgagaaatatttgatg
agtatagaagatgctcttatatcttatcctaaattaacagtcaataattcatttacaaag
ttattagtaaatggagtaaaggtgtatgataaaagattaagtgatgaagttatagaaaat
gatattttgtatagggtatatgataaaaagaatacttttataggacttggaaagcgagac
aataaaggatttaaaatacaaaagttattattttaa

DBGET integrated database retrieval system