KEGG   Chryseobacterium taklimakanense: 4412677_00283Help
Entry
4412677_00283     CDS       T05512                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak00260  Glycine, serine and threonine metabolism
ctak01100  Metabolic pathways
ctak01110  Biosynthesis of secondary metabolites
ctak01120  Microbial metabolism in diverse environments
ctak01130  Biosynthesis of antibiotics
ctak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4412677_00283 (ltaE)
Enzymes [BR:ctak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     4412677_00283 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: SNV34211
UniProt: A0A239WI54
Position
1:291313..292386
Genome map
AA seq 357 aa AA seqDB search
MLNLLTENFYNNTKTMKYSFKNDYSEGCHPRILERLIETNLAQQNGYGLDEYCLEAEKLI
QQKINNPKAKVHFISGGTQANLIVISSVLRPHESVVSAFTGHIFTNESGAIEATGHKVHG
VETADGKLRPQDIQEVLDVHTNIPHQVRQKVVYISNSTEIGTVYSKKELQELSDFCKGKN
LYLFMDGARLGHALTAETNDLTLEEVAQLVDVFYLGGTKNGALIGEAIVIVNEKLQEEFG
FHIKQRGAMLAKGRLLGIQFLELLKDDLYFKLAAHANQQAMKLKAAFMEIGCGFLTETFS
NQIFPVLKNDQIEKLYQNYDFYVWKKIDAEKSAIRLITSWATQDEIIERYIQEIKKL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatttactcactgaaaacttttacaacaacacaaaaacaatgaaatactcattc
aagaacgattattccgaaggctgccatccgaggattttagaacgcttaattgaaaccaat
ctcgcgcaacaaaacggctatgggctcgatgaatattgtctggaagctgaaaagcttatc
cagcaaaaaatcaataatccaaaagcgaaagttcatttcatttcaggtggaacccaggcg
aatctgatcgttatttcatctgttttacggccccacgaaagcgtggtttctgcctttacg
gggcatatctttaccaatgaaagcggtgcaatagaagcgaccggacataaagttcacggc
gtagaaacagctgatggtaagcttcgtcctcaggatattcaggaggtcttggatgtacac
accaacataccgcatcaggtgcggcaaaaggtggtttatatttcaaattccacggaaata
ggaacagtgtacagcaaaaaggaacttcaggagttatctgacttttgtaaaggaaagaac
ctttatttgtttatggacggcgcgaggctgggacacgctttaactgccgaaaccaatgac
ttgacgctggaagaagtggcccaacttgttgacgttttctacttgggaggaacaaaaaat
ggagctctgatcggcgaggccatcgtcatcgtcaatgaaaaactgcaggaagaatttggc
ttccacatcaaacagagaggcgcaatgctggcgaagggaagattgttaggaattcagttt
ctggaactgttgaaagatgatctgtattttaagcttgccgctcatgccaatcagcaggcg
atgaaactcaaagccgcgtttatggagatcggttgcggattccttacagaaacgttcagc
aatcagatttttcccgttttaaaaaatgatcagatcgaaaaactttaccaaaattatgat
ttttatgtctggaagaagatcgatgctgaaaagtcggcaattcgcttgatcacgtcctgg
gctacacaggatgaaattatcgaaagatatatacaggaaattaaaaaactttga

DBGET integrated database retrieval system